Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182725

Prenylcysteine Oxidase 1 (PCYOX1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PCL1, Pcly, AI115532, AI448340, 1200015P13Rik, Clp55, pcl1, zgc:110246, PCYOX1, DKFZp459K115
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN182725
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PCYOX1 antibody: synthetic peptide directed towards the C terminal of human PCYOX1
Sequence IFSQETLTKAQILKLFLSYDYAVKKPWLAYPHYKPPEKCP SIILHDRLYY
Predicted Reactivity Human : 100%, Rabbit : 100%, Dog : 85%, Horse : 85%
Characteristics This is a rabbit polyclonal antibody against PCYOX1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name PCYOX1
Background Prenylated proteins contain one of two isoprenoid lipids, either the 15-carbon farnesyl or the 20-carbon geranylgeranyl, covalently attached to cysteine residues at or near their C terminus. PCYOX1 is capable of cleaving the thioether bond of prenylcysteines. The enzyme was isolated from bovine brain membranes and exhibits an apparent molecular mass of 63 kDa. This is a specific enzyme involved in prenylcysteine metabolism in mammalian cells, most likely comprising the final step in the degradation of prenylated proteins.
Molecular Weight 57kDa
Gene ID 51449
NCBI Accession NP_057381, NM_016297
UniProt Q9UHG3
Research Area Signaling, Metabolism, Organelles
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PCYOX1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Alternatives for antigen "Prenylcysteine Oxidase 1 (PCYOX1)", type "Antibodies"
Hosts (6), (3)
Reactivities (9), (2), (2), (1), (1)
Applications (6), (5), (3), (2)
Epitopes (2), (2), (1), (1)
Beacon