Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182817

Wolf-Hirschhorn Syndrome Candidate 1 (WHSC1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
MMSET, NSD2, REIIBP, TRX5, WHS, 5830445G22Rik, 9430010A17Rik, AW555663, C130020C13Rik, D030027O06Rik, D930023B08Rik, Whsc1l, mKIAA1090, RGD1565590, WHSC1, fc12c04, wu:fc12c04, wu:fi20c01, si:rp71-77d7 ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182817
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-WHSC1 antibody: synthetic peptide directed towards the N terminal of human WHSC1
Sequence KYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKS ARQYHVQFFG
Predicted Reactivity Chicken : 100%, Horse : 100%, Human : 100%, Guinea pig : 87%, Mouse : 85%, Dog : 76%, Rabbit : 76%
Characteristics This is a rabbit polyclonal antibody against WHSC1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name WHSC1
Background WHSC1 encodes a protein that contains four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain, and a PHD-type zinc finger. It is expressed ubiquitously in early development. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4.
Molecular Weight 88kDa
Gene ID 7468
NCBI Accession NP_055734, NM_014919
UniProt O96031
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-WHSC1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Santra, Zhan, Tian et al.: "A subset of multiple myeloma harboring the t(4;14)(p16;q32) translocation lacks FGFR3 expression but maintains an IGH/MMSET fusion transcript." in: Blood, Vol. 101, Issue 6, pp. 2374-6, 2003 (PubMed).

Alternatives for antigen "Wolf-Hirschhorn Syndrome Candidate 1 (WHSC1)", type "Antibodies"
Hosts (8), (4), (1)
Reactivities (13), (1), (1), (1)
Applications (11), (4), (1), (1), (1), (1)
Epitopes (3), (3), (2), (1), (1)
Beacon