Wolf-Hirschhorn Syndrome Candidate 1 (WHSC1) (N-Term) antibody

Details for Product No. ABIN182817
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
MMSET, NSD2, REIIBP, TRX5, WHS, 5830445G22Rik, 9430010A17Rik, AW555663, C130020C13Rik, D030027O06Rik, D930023B08Rik, Whsc1l, mKIAA1090, RGD1565590, WHSC1, fc12c04, wu:fc12c04, wu:fi20c01, si:rp71-77d7 ... show more
MMSET, NSD2, REIIBP, TRX5, WHS, 5830445G22Rik, 9430010A17Rik, AW555663, C130020C13Rik, D030027O06Rik, D930023B08Rik, Whsc1l, mKIAA1090, RGD1565590, WHSC1, fc12c04, wu:fc12c04, wu:fi20c01, si:rp71-77d7.2, whs, nsd2, trx5, mmset, reiibp show less
Epitope
N-Term
(8), (7), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human, Chicken
(18), (1), (1), (1)
Host
Rabbit
(15), (2), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(16), (8), (1), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN182817
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human WHSC1
Sequence KYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKS ARQYHVQFFG
Predicted Reactivity Chicken : 100 %, Horse : 100 %, Human : 100 %, Guinea pig : 80 %, Mouse : 80 %, Dog : 70 %, Rabbit : 70 %
Characteristics This is a rabbit polyclonal antibody against WHSC1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name WHSC1
Background WHSC1 encodes a protein that contains four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain, and a PHD-type zinc finger. It is expressed ubiquitously in early development. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4.
Molecular Weight 88 kDa
Gene ID 7468
NCBI Accession NM_014919, NP_055734
UniProt O96031
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 802 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Wolf-Hirschhorn Syndrome Candidate 1 (WHSC1) (N-Term) antibody WB Suggested Anti-WHSC1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Santra, Zhan, Tian et al.: "A subset of multiple myeloma harboring the t(4;14)(p16;q32) translocation lacks FGFR3 expression but maintains an IGH/MMSET fusion transcript." in: Blood, Vol. 101, Issue 6, pp. 2374-6, 2003 (PubMed).

Hosts (15), (2), (1)
Reactivities (18), (1), (1), (1)
Applications (16), (8), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top