Mediator Complex Subunit 17 (MED17) (N-Term) antibody

Details for Product No. ABIN182953
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CRSP6, CRSP77, DRIP80, TRAP80, 77kDa, Crsp6, Trap80, C330002H14Rik
Epitope
N-Term
(3), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Rat (Rattus), Dog (Canine), Mouse (Murine), Cow (Bovine), Xenopus laevis, Human, Chicken
(42), (25), (14), (13), (12), (12), (12)
Host
Rabbit
(33), (10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB), Chromatin Immunoprecipitation (ChIP)
(30), (19), (10), (7), (6), (4), (2)
Pubmed 1 reference available
Catalog no. ABIN182953
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CRSP6
Sequence AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWK LRKVGDKILG
Predicted Reactivity Rat :100 %,   Dog :100 %,   Bovine :100 %,   Human :100 %,   Mouse :90 %,   African clawed frog :80 %,   Western clawed frog :80 %,   Chicken :80 %,  
Characteristics This is a rabbit polyclonal antibody against CRSP6. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name CRSP6
Background The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by CRSP6 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.
Molecular Weight 73 kDa
Gene ID 9440
NCBI Accession NM_004268, NP_004259
UniProt Q9NVC6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 651 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Mediator Complex Subunit 17 (MED17) (N-Term) antibody WB Suggested Anti-CRSP6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
anti-Mediator Complex Subunit 17 (MED17) (N-Term) antibody (2) anti-Mediator Complex Subunit 17 (MED17) (N-Term) antibody (Image 2)
Background publications Wang, Sharma, Ren et al.: "A coregulatory role for the TRAP-mediator complex in androgen receptor-mediated gene expression." in: The Journal of biological chemistry, Vol. 277, Issue 45, pp. 42852-8, 2002 (PubMed).

Hosts (33), (10)
Reactivities (42), (25), (14), (13), (12), (12), (12)
Applications (30), (19), (10), (7), (6), (4), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (2), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top