Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183055

Ring Finger Protein 135 (RNF135) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MMFD, REUL, Riplet, 0610037N03Rik, 2410006N06Rik, LRRGT00184
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183055
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RNF135 antibody: synthetic peptide directed towards the middle region of human RNF135
Sequence DILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSC PLPDQSHPAL
Predicted Reactivity Human : 100%, Bovine : 92%, Dog : 92%, Guinea pig : 90%, Mouse : 85%
Characteristics This is a rabbit polyclonal antibody against RNF135. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RNF135
Background The protein encoded by RNF135 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is located in a chromosomal region known to be frequently deleted in patients with neurofibromatosis.
Molecular Weight 48kDa
Gene ID 84282
NCBI Accession NP_115698, NM_032322
UniProt Q8IUD6
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RNF135 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Petroziello, Yamane, Westendorf et al.: "Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer." in: Oncogene, Vol. 23, Issue 46, pp. 7734-45, 2004 (PubMed).

Alternatives for antigen "Ring Finger Protein 135 (RNF135)", type "Antibodies"
Hosts (20), (1)
Reactivities (21), (12), (12), (12), (12)
Applications (12), (10), (4), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (2), (1), (1)
Beacon