Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183557

Endothelial Differentiation Related Factor 1 (EDF1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EDF-1, MBF1, 0610008L11Rik, AA409425, CAP-19, zgc:73192, zgc:86829
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Pig (Porcine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN183557
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EDF1 antibody: synthetic peptide directed towards the N terminal of human EDF1
Sequence MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVET SKKWAAGQNK
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against EDF1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name EDF1
Background EDF1 encodes a protein that may regulate endothelial cell differentiation. It has been postulated that the protein functions as a bridging molecule that interconnects regulatory proteins and the basal transcriptional machinery, thereby modulating the transcription of genes involved in endothelial differentiation. This protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Two alternatively spliced transcripts which encode distinct proteins have been found for this gene.
Molecular Weight 16kDa
Gene ID 8721
NCBI Accession NP_003783, NM_003792
UniProt O60869
Research Area Signaling, Metabolism, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EDF1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Brendel, Gelman, Auwerx: "Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism." in: Molecular endocrinology (Baltimore, Md.), Vol. 16, Issue 6, pp. 1367-77, 2002 (PubMed).

Brendel, Schoonjans, Botrugno et al.: "The small heterodimer partner interacts with the liver X receptor alpha and represses its transcriptional activity." in: Molecular endocrinology (Baltimore, Md.), Vol. 16, Issue 9, pp. 2065-76, 2002 (PubMed).

Alternatives for antigen "Endothelial Differentiation Related Factor 1 (EDF1)", type "Antibodies"
Hosts (8), (4), (4)
Reactivities (16), (5), (5), (2), (2), (2), (1), (1), (1)
Applications (13), (5), (5), (4), (4), (2)
Epitopes (3), (3), (3), (2), (1)
Beacon