Did you know that you can buy products from over 140 different suppliers from us?

MDS1 and EVI1 Complex Locus (MECOM) (N-Term) antibody

Details for Product No. ABIN183666
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AML1-EVI-1, EVI1, MDS1, MDS1-EVI1, PRDM3, D630039M04Rik, Evi-1, Evi1, Jbo, Mds, Mds1, Mds1-Evi1, Prdm3, Znfpr1b1, evi1, im:7140716, prdm3
Epitope
N-Term
(24), (10), (10), (8), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Human
(62), (8), (3), (2), (2), (2)
Host
Rabbit
(40), (24), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (3), (3), (3)
Application
Western Blotting (WB)
(61), (31), (4), (3), (2), (2), (1), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183666
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MDS1
Sequence MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPS LNIQEPCSPA
Predicted Reactivity Human : 100 %, Mouse : 90 %
Characteristics This is a rabbit polyclonal antibody against MDS1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name MDS1
Background MDS1 is located at 3q26 170-400 kb upstream (telomeric) of EVI1 in the chromosomal region in which some of the breakpoints 5' of EVI1 have been mapped. MDS1 has been identified as a single gene as well as a previously unreported exon(s) of EVI1. MDS1 exists in normal tissues both as a unique transcript and as a normal fusion transcript with EVI1, with an additional 188 codons at the 5' end of the previously reported EVI1 open reading frame. In cells with translocation t (3,21), additional fusion transcripts are AML1-MDS1 and AML1-MDS1-EVI1. EVI1 and MDS1 are involved in leukemia associated with chromosomal translocation breakpoints in the region between these genes.
Molecular Weight 19 kDa
Gene ID 4197
NCBI Accession NM_004991, NP_004982
UniProt Q13465
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 169 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-MDS1 and EVI1 Complex Locus (MECOM) (N-Term) antibody WB Suggested Anti-MDS1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Raji cell lysate
Background publications Fears, Mathieu, Zeleznik-Le et al.: "Intergenic splicing of MDS1 and EVI1 occurs in normal tissues as well as in myeloid leukemia and produces a new member of the PR domain family." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 93, Issue 4, pp. 1642-7, 1996 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183666
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top