Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183666

MDS1 and EVI1 Complex Locus (MECOM) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AML1-EVI-1, EVI1, MDS1, MDS1-EVI1, PRDM3, D630039M04Rik, Evi-1, Evi1, Jbo, Mds, Mds1, Mds1-Evi1, Prdm3, Znfpr1b1, evi1, im:7140716, prdm3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183666
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MDS1 antibody: synthetic peptide directed towards the N terminal of human MDS1
Sequence MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPS LNIQEPCSPA
Predicted Reactivity Human : 100%, Mouse : 92%
Characteristics This is a rabbit polyclonal antibody against MDS1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name MDS1
Background MDS1 is located at 3q26 170-400 kb upstream (telomeric) of EVI1 in the chromosomal region in which some of the breakpoints 5' of EVI1 have been mapped. MDS1 has been identified as a single gene as well as a previously unreported exon(s) of EVI1. MDS1 exists in normal tissues both as a unique transcript and as a normal fusion transcript with EVI1, with an additional 188 codons at the 5' end of the previously reported EVI1 open reading frame. In cells with translocation t (3,21), additional fusion transcripts are AML1-MDS1 and AML1-MDS1-EVI1. EVI1 and MDS1 are involved in leukemia associated with chromosomal translocation breakpoints in the region between these genes.
Molecular Weight 19kDa
Gene ID 4197
NCBI Accession NP_004982, NM_004991
UniProt Q13465
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MDS1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Fears, Mathieu, Zeleznik-Le et al.: "Intergenic splicing of MDS1 and EVI1 occurs in normal tissues as well as in myeloid leukemia and produces a new member of the PR domain family." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 93, Issue 4, pp. 1642-7, 1996 (PubMed).

Alternatives for antigen "MDS1 and EVI1 Complex Locus (MECOM)", type "Antibodies"
Hosts (26), (17), (2)
Reactivities (41), (10), (2), (2), (2), (2)
Applications (41), (14), (4), (2), (2), (2)
Epitopes (14), (5), (4), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1)
Beacon