Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183776

Lysine (K)-Specific Demethylase 3B (KDM3B) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 5qNCA, C5orf7, JMJD1B, NET22, JHDM2B, Jmjd1b, mKIAA1082, 5830462I21Rik, KDM3B
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Fruit Fly (Drosophila melanogaster), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183776
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-JMJD1B antibody: synthetic peptide directed towards the C terminal of human JMJD1B
Sequence VHNLYSCIKVAEDFVSPEHVKHCFRLTQEFRHLSNTHTNH EDKLQVKNII
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against JMJD1B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name JMJD1B
Background JMJD1B contains a highly-conserved C-terminus containing a zinc finger with the unique spacing Cys-X2-Cys-X7-His-X2-Cys-X2-Cys-X4-Cys-X2-Cys and a jmjC domain. It plays an important role in histone demethylation and may be a candidate for tumor suppressors.
Molecular Weight 192kDa
Gene ID 51780
NCBI Accession NP_057688, NM_016604
UniProt Q7LBC6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-JMJD1B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hu, Gomes, Horrigan et al.: "A novel nuclear protein, 5qNCA (LOC51780) is a candidate for the myeloid leukemia tumor suppressor gene on chromosome 5 band q31." in: Oncogene, Vol. 20, Issue 47, pp. 6946-54, 2001 (PubMed).

Alternatives for antigen "Lysine (K)-Specific Demethylase 3B (KDM3B)", type "Antibodies"
Hosts (44), (2)
Reactivities (46), (24), (20), (13), (13), (13), (1), (1)
Applications (33), (20), (10), (8), (7), (4), (4), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (5), (4), (3), (2), (2), (2), (2), (1), (1), (1), (1)
Beacon