Did you know that you can buy products from over 140 different suppliers from us?

Protein Arginine Methyltransferase 2 (PRMT2) (N-Term) antibody

Details for Product No. ABIN183891
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HRMT1L1, AI504737, Hrmt1l1, PRMT2, DKFZp459N1919
Epitope
N-Term
(13), (10), (2), (2), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Dog (Canine), Human
(57), (3), (2), (1), (1)
Host
Rabbit
(39), (21), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(55), (23), (12), (11), (4), (2), (2), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183891
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PRMT2
Sequence ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLS FLRGEKILIL
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Dog : 90 %, Guinea pig : 90 %
Characteristics This is a rabbit polyclonal antibody against PRMT2. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name PRMT2
Background The protein arginine methyltransferases (PRMTs) include a family of proteins with related putative methyltransferase domains that modify chromatin and regulate cellular transcription. PRMT2 inhibits NF-kappaB-dependent transcription and promotes apoptosis and it exerts this effect by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding. PRMT2 also rendered cells susceptible to apoptosis by cytokines or cytotoxic drugs, likely due to its effects on NF-kappaB.
Molecular Weight 48 kDa
Gene ID 3275
NCBI Accession NM_001535, NP_001526
UniProt P55345
Research Area Chromatin and Nuclear Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 433 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Protein Arginine Methyltransferase 2 (PRMT2) (N-Term) antibody WB Suggested Anti-PRMT2 Antibody Titration: 0.625ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
anti-Protein Arginine Methyltransferase 2 (PRMT2) (N-Term) antibody (2) anti-Protein Arginine Methyltransferase 2 (PRMT2) (N-Term) antibody (Image 2)
anti-Protein Arginine Methyltransferase 2 (PRMT2) (N-Term) antibody (3) anti-Protein Arginine Methyltransferase 2 (PRMT2) (N-Term) antibody (Image 3)
Background publications Qi, Chang, Zhu et al.: "Identification of protein arginine methyltransferase 2 as a coactivator for estrogen receptor alpha." in: The Journal of biological chemistry, Vol. 277, Issue 32, pp. 28624-30, 2002 (PubMed).

Hosts (39), (21), (1)
Reactivities (57), (3), (2), (1), (1)
Applications (55), (23), (12), (11), (4), (2), (2), (2)
Conjugates (2), (2), (2), (2), (2), (2)
Epitopes (13), (10), (2), (2), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183891
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top