Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183913

Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
RNPU1Z, RPU1, SNRP70, Snp1, U1-70K, U170K, U1AP, U1RNP, snrp70, 2700022N21Rik, 3200002N22Rik, 70kDa, AI325098, R74807, Rnulp70, Snrp70, Srnp70, U1-70, wu:fc20b04, zgc:136450, rnpu1z, rpu1, u170k, u1ap ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Zebrafish (Danio rerio)
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN183913
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SNRP70 antibody: synthetic peptide directed towards the N terminal of human SNRP70
Sequence PHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIK RIHMVYSKRS
Predicted Reactivity Mouse :100%,   Human :100%,   Western clawed frog :100%,   Bovine :100%,   Zebrafish :100%,   African clawed frog :100%,   Dog :100%,   Rat :100%,   African malaria mosquito :92%,   Yellowfever mosquito :92%,   Mosquito :92%,   Harpegnathos saltator :92%,   Camponotus floridanus :92%,   Brown alga :92%,   Red flour beetle :92%,   Florida lancelet :92%,   Black-legged tick :92%,   Trichoplax reptans :92%,   Fruit fly :92%,   Caenorhabditis elegans :85%,   Caenorhabditis vulgaris :85%,   Eye worm :85%,   Body louse :85%,   Caenorhabditis briggsae :85%,   Filarial nematode worm :85%,   Planarian :85%,   Starlet sea anemone :85%,   Toxoplasma gondii ME49 :84%,   Toxoplasma gondii :84%,   Blood fluke :83%,   Moss :76%,   Spikemoss :76%,   Volvox carteri f. nagariensis :76%,   Chlorella variabilis :76%,   Chlamydomonas smithii :76%,  
Characteristics This is a rabbit polyclonal antibody against SNRP70. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name SNRP70
Background SNRP70 contains 1 RRM (RNA recognition motif) domain and mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Molecular Weight 48kDa
Gene ID 6625
NCBI Accession NP_003080, NM_003089
UniProt P08621
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SNRP70 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Zhang, Walker, Tamplin et al.: "Zfp206 regulates ES cell gene expression and differentiation." in: Nucleic acids research, Vol. 34, Issue 17, pp. 4780-90, 2006 (PubMed).

Alternatives for antigen "Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70)", type "Antibodies"
Hosts (13), (4), (1)
Reactivities (15), (2), (2), (2), (1), (1), (1)
Applications (14), (5), (5), (1)
Epitopes (3), (2), (2), (1), (1), (1)
Beacon