Did you know that you can buy products from over 140 different suppliers from us?

Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70) (N-Term) antibody

Details for Product No. ABIN183913
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
rnpu1z, rpu1, snrp70, u170k, u1ap, u1rnp, SNRP70, wu:fc20b04, zgc:136450, 2700022N21Rik, 3200002N22Rik, 70kDa, AI325098, R74807, Rnulp70, Snrp70, Srnp70, U1-70, U1-70K, RNPU1Z, RPU1, Snp1, U170K, U1AP ... show more
rnpu1z, rpu1, snrp70, u170k, u1ap, u1rnp, SNRP70, wu:fc20b04, zgc:136450, 2700022N21Rik, 3200002N22Rik, 70kDa, AI325098, R74807, Rnulp70, Snrp70, Srnp70, U1-70, U1-70K, RNPU1Z, RPU1, Snp1, U170K, U1AP, U1RNP show less
Epitope
N-Term
(7), (6), (3), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Zebrafish (Danio rerio)
(22), (3), (3), (2), (1), (1), (1), (1)
Host
Rabbit
(20), (4), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(22), (11), (5)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183913
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SNRP70
Sequence PHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIK RIHMVYSKRS
Predicted Reactivity Mouse :100 %,   Human :100 %,   Western clawed frog :100 %,   Bovine :100 %,   Zebrafish :100 %,   African clawed frog :100 %,   Dog :100 %,   Rat :100 %,   African malaria mosquito :90 %,   Yellowfever mosquito :90 %,   Mosquito :90 %,   Harpegnathos saltator :90 %,   Camponotus floridanus :90 %,   Brown alga :90 %,   Red flour beetle :90 %,   Florida lancelet :90 %,   Black-legged tick :90 %,   Trichoplax reptans :90 %,   Fruit fly :90 %,   Caenorhabditis elegans :80 %,   Caenorhabditis vulgaris :80 %,   Eye worm :80 %,   Body louse :80 %,   Caenorhabditis briggsae :80 %,   Filarial nematode worm :80 %,   Planarian :80 %,   Starlet sea anemone :80 %,   Toxoplasma gondii ME49 :80 %,   Toxoplasma gondii :80 %,   Blood fluke :80 %,   Moss :70 %,   Spikemoss :70 %,   Volvox carteri f. nagariensis :70 %,   Chlorella variabilis :70 %,   Chlamydomonas smithii :70 %,  
Characteristics This is a rabbit polyclonal antibody against SNRP70. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name SNRP70
Background SNRP70 contains 1 RRM (RNA recognition motif) domain and mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA.
Molecular Weight 48 kDa
Gene ID 6625
NCBI Accession NM_003089, NP_003080
UniProt P08621
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 437 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70) (N-Term) antibody WB Suggested Anti-SNRP70 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
anti-Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70) (N-Term) antibody (2) anti-Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70) (N-Term) antibody (Image 2)
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

General Zhang, Walker, Tamplin et al.: "Zfp206 regulates ES cell gene expression and differentiation." in: Nucleic acids research, Vol. 34, Issue 17, pp. 4780-90, 2006 (PubMed).

Validation Images
back to top