SNRNP70 antibody

Catalog No. ABIN630004

This Rabbit Polyclonal antibody specifically detects SNRNP70 in WB and IHC. It exhibits reactivity toward Human, Rat, Mouse, Dog and Zebrafish (Danio rerio).

Quick Overview for SNRNP70 antibody (ABIN630004)

Target: SNRNP70 (Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70))

Reactivity: Human, Rat, Mouse, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNRNP70 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SNRNP70 Antibody

Purification: Purified

Immunogen: SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNRP70 Blocking Peptide, (ABIN936145), is also available for use as a blocking control in assays to test for specificity of this SNRP70 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRP70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNRNP70

Target: SNRNP70 (Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70))

Alternative Name: SNRP70

Background: SNRP70 contains 1 RRM (RNA recognition motif) domain and mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA.

Molecular Weight: 48 kDa (MW of target protein)