Did you know that you can buy products from over 140 different suppliers from us?

Exosome Component 2 (EXOSC2) (N-Term) antibody

Details for Product No. ABIN184031
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EXOSC2, exosc2, MGC97533, RRP4, Rrp4p, hRrp4p, p7, Rrp4, fa97b01, wu:fa97b01, zgc:110117
Epitope
N-Term
(2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(20), (4), (4), (1), (1), (1), (1), (1)
Host
Rabbit
(12), (10)
Clonality
Polyclonal
Application
Western Blotting (WB)
(14), (8), (5), (4), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN184031
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human EXOSC2
Sequence RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEE KLIASVAGSV
Predicted Reactivity Human : 100 %, Dog : 80 %, Mouse : 80 %, Rat : 80 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against EXOSC2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name EXOSC2
Background EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3' processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3'-5' exoribonuclease activity.
Molecular Weight 32 kDa
Gene ID 23404
NCBI Accession NM_014285, NP_055100
UniProt Q13868
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 293 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Exosome Component 2 (EXOSC2) (N-Term) antibody WB Suggested Anti-EXOSC2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
anti-Exosome Component 2 (EXOSC2) (N-Term) antibody (2) Rabbit Anti-EXOSC2 Antibody ,Paraffin Embedded Tissue: Human Lung cell
Cellular Data: alveolar cell of renal tubule
Antibody Concentration: 4.0-8.0 µg/mL
Magnification:.00X
anti-Exosome Component 2 (EXOSC2) (N-Term) antibody (3) WB Suggested Anti-EXOSC2
Antibody Titration: 1.25 µg/mL ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
EXOSC2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Validation Images
back to top