Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184031

Exosome Component 2 (EXOSC2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms p7, RRP4, Rrp4p, hRrp4p, Rrp4, fa97b01, wu:fa97b01, zgc:110117, EXOSC2, exosc2, MGC97533
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN184031
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EXOSC2 antibody: synthetic peptide directed towards the N terminal of human EXOSC2
Sequence RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEE KLIASVAGSV
Predicted Reactivity Human : 100%, Dog : 85%, Mouse : 85%, Rat : 85%, Guinea pig : 84%
Characteristics This is a rabbit polyclonal antibody against EXOSC2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name EXOSC2
Background EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3' processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3'-5' exoribonuclease activity.
Molecular Weight 32kDa
Gene ID 23404
NCBI Accession NP_055100, NM_014285
UniProt Q13868
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EXOSC2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Alternatives for antigen "Exosome Component 2 (EXOSC2)", type "Antibodies"
Hosts (10), (9)
Reactivities (16), (3), (3), (2), (1), (1), (1), (1)
Applications (11), (9), (4), (3), (2)
Epitopes (2), (1), (1), (1), (1)
Beacon