Add to Basket
Order hotline:
 |
+1 404 474 4654 |
 |
+1 888 205 9894 (TF) |
Defensin, beta 4A (DEFB4) (AA 4-41) antibody
| Antigen | Defensin, beta 4A (DEFB4) |
| Synonyms |
SAP1, DEFB2, HBD-2, DEFB-2, DEFB102, MGC129140, MGC129141, MBD-4, 2310001F05Rik, Defb2, Defb3, BD-4, DEFB4, hBD-4, DEFB-4, DEFB104, MGC118942, MGC118944, MGC118945, GAL2, PBD-2, GAL4, BD2, DEFB4P, DEF ...
show more
|
| Epitope |
 Alternatives AA 4-41 |
| Clonality | Monoclonal (L12-4C-C2) |
| Host |
Alternatives Mouse |
| Reactivity |
Alternatives Human |
| Application |
Alternatives Enzyme Immunoassay (EIA), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
|
| Catalog no. | ABIN191996 |
| Quantity | 10 µg (Variants) |
| Price | 245.00 $ Plus shipping costs $35.00 |
| Shipping to |
|
| Availability | Ships within 7 to 10 Business Days |
Additional Information
| Characteristics | Synonyms: Beta-defensin 4A, Beta-defensin 2, BD-2, hBD-2, DEFB102, DEFB2, Skin-antimicrobialpeptide 1, DEFB4B, DEFB4A |
| Alternative name | Defensin beta 2 |
| Swiss-Prot | O15263 |
| Immunogen | Synthetic peptide corresponding to amino acids 4-41 of Human beta-Defensin 2. AA Sequence: DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
| Cross-Reactivity | Human |
| Isotype | IgG1 (Matching secondary antibodies) |
| Clone | L12-4C-C2 |
| Description | This antibiotic peptide is locally regulated by inflammation. Defensins form a family ofmicrobicidal and cytotoxic peptides made by neutrophils. Members of the defensin familyare highly similar in protein sequence. |
| Specificity | This antibody recognizes beta-Defensin 2 (aa 4-41). Species Reactivity: Tested: Human. Add. Information: LocusID 1673 |
| Synonyms | SAP1, DEFB2, HBD-2, DEFB-2, DEFB102, MGC129140, MGC129141, MBD-4, 2310001F05Rik, Defb2, Defb3, BD-4, DEFB4, hBD-4, DEFB-4, DEFB104, MGC118942, MGC118944, MGC118945, GAL2, PBD-2, GAL4, BD2, DEFB4P, DEFB104A, THP2, DEFB104B, BD-2 |
Application Details
| Application Notes | ELISA. Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user. |
| Purification | Purified |
| Buffer | 50 mM TRIS pH 7.4Reconstitution: Restore in aqua bidest to 1 mg/ml. |
| Storage | Store lyophilized at 2-8°C and reconstituted at -20°C. Avoid repeated freezing and thawing. Shelf life: One year from despatch. |
| Restrictions | For Research Use only |
Alternatives
Alternatives for antigen "Defensin, beta 4A (DEFB4)", type "Antibodies"
| Hosts | Rabbit (26), Mouse (9), Sheep (8), Goat (7) |
| Reactivities | Human (33), Rat (Rattus) (20), Mouse (Murine) (5), Cow (Bovine) (1) |
| Applications | Western Blotting (WB) (21), Immunofluorescence (IF) (19), Flow Cytometry (FACS) (18), ELISA (16), Enzyme Immunoassay (EIA) (14), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Radioimmunoassay (RIA) (5), Immunohistochemistry (IHC) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (Frozen Sections) (IHC (fro)) (2), Immunoprecipitation (IP) (2), Dot Blot (Dot) (1), Immunoelectron Microscopy (IEM) (1) |
| Conjugates | Biotin (4), Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1) |
| Epitopes | AA 4-41 (12), AA 3-39 (4) |
