Defensin, beta 4A (DEFB4) (AA 4-41) antibody

Details for Product No. ABIN191996
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Synonyms BD-2, DEFB-2, DEFB102, DEFB2, DEFB4, HBD-2, SAP1, BD2, DEFB4P, THP2, DEFB104, DEFB104B
AA 4-41
(12), (10), (6), (3), (3), (1), (1), (1), (1), (1), (1)
(50), (20), (13), (2), (2), (2), (2), (1)
(60), (12), (12), (6)
Clonality (Clone)
Monoclonal ()
(7), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
ELISA, Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(68), (57), (22), (20), (13), (10), (9), (4), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN191996
Quantity 10 µg
286.00 $   Plus shipping costs $45.00
Shipping to United States (Change)
Availability Will be delivered in 6 to 8 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide corresponding to amino acids 4-41 of Human beta-Defensin 2. AA Sequence: DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Clone L12-4C-C2
Isotype IgG1
Characteristics Synonyms: Beta-defensin 4A, Beta-defensin 2, BD-2, hBD-2, DEFB102, DEFB2, Skin-antimicrobialpeptide 1, DEFB4B, DEFB4A
Purification Protein G Chromatography
Alternative Name Defensin beta 2
Background This antibiotic peptide is locally regulated by inflammation. Defensins form a family ofmicrobicidal and cytotoxic peptides made by neutrophils. Members of the defensin familyare highly similar in protein sequence.
UniProt O15263
Research Area Immunology
Application Notes ELISA. Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Restore in 0.1 mL aqua bidest to 1 mg/mL.
Buffer 50mM TRIS pH 7.4
Storage 4 °C/-20 °C
Storage Comment Store lyophilized at 2-8°C and reconstituted at -20°C. Avoid repeated freezing and thawing. Shelf life: One year from despatch.
Expiry Date 12 months
Supplier Images
anti-Defensin, beta 4A (DEFB4) (AA 4-41) antibody anti-Defensin, beta 4A (DEFB4) (AA 4-41) antibody
Background publications Langhorst, Junge, Rueffer et al.: "Elevated human beta-defensin-2 levels indicate an activation of the innate immune system in patients with irritable bowel syndrome." in: The American journal of gastroenterology, Vol. 104, Issue 2, pp. 404-10, 2009 (PubMed).

Hosts (60), (12), (12), (6)
Reactivities (50), (20), (13), (2), (2), (2), (2), (1)
Applications (68), (57), (22), (20), (13), (10), (9), (4), (2), (1), (1)
Conjugates (7), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (12), (10), (6), (3), (3), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top