Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309977

Zinc Finger and BTB Domain Containing 9 (ZBTB9) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF919, 3930402F13Rik
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN309977
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZBTB9 antibody: synthetic peptide directed towards the C terminal of human ZBTB9
Sequence HHLTEHMKTHAGALHACPHCGRRFRVHACFLRHRDLCKGQ GWATAHWTYK
Predicted Reactivity Bovine : 100%, Horse : 100%, Human : 100%, Guinea pig : 85%, Mouse : 85%, Rat : 85%, African clawed frog : 78%
Characteristics This is a rabbit polyclonal antibody against ZBTB9. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZBTB9
Background ZBTB9 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers. It may be involved in transcriptional regulation.
Molecular Weight 51kDa
Gene ID 221504
NCBI Accession NP_689948, NM_152735
UniProt Q96C00
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZBTB9 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Background publications Gunnarsdóttir, Li, Bauchet et al.: "High-throughput sequencing of complete human mtDNA genomes from the Philippines." in: Genome research, Vol. 21, Issue 1, pp. 1-11, 2011 (PubMed).

Alternatives for antigen "Zinc Finger and BTB Domain Containing 9 (ZBTB9)", type "Antibodies"
Hosts (18), (1)
Reactivities (18), (9), (1)
Applications (19), (7), (7), (3), (1)
Epitopes (11), (2), (1)
Beacon