Zinc Finger and BTB Domain Containing 9 (ZBTB9) (C-Term) antibody

Details for Product No. ABIN309977
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF919, 3930402F13Rik
Epitope
C-Term
(11), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(18), (10), (1)
Host
Rabbit
(18), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(19), (8), (7), (3), (1)
Pubmed 2 references available
Catalog no. ABIN309977
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human ZBTB9
Sequence HHLTEHMKTHAGALHACPHCGRRFRVHACFLRHRDLCKGQ GWATAHWTYK
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Human : 100 %, Guinea pig : 80 %, Mouse : 80 %, Rat : 80 %, African clawed frog : 70 %
Characteristics This is a rabbit polyclonal antibody against ZBTB9. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZBTB9
Background ZBTB9 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers. It may be involved in transcriptional regulation.
Molecular Weight 51 kDa
Gene ID 221504
NCBI Accession NM_152735, NP_689948
UniProt Q96C00
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 473 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Background publications Gunnarsdóttir, Li, Bauchet et al.: "High-throughput sequencing of complete human mtDNA genomes from the Philippines." in: Genome research, Vol. 21, Issue 1, pp. 1-11, 2011 (PubMed).

Hosts (18), (1)
Reactivities (18), (10), (1)
Applications (19), (8), (7), (3), (1)
Epitopes (11), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top