Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310396

Forkhead Box R2 (FOXR2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FOXN6, EG436240, Foxn6, RGD1564437, FOXR2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310396
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FOXR2 antibody: synthetic peptide directed towards the N terminal of human FOXR2
Sequence VDPNILCPLGSQEAPKPSGKEDLTNISPFPQPPQKDEGSN CSEDKVVESL
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against FOXR2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name FOXR2
Background Forkhead-box (FOX) transcription factors are implicated in carcinogenesis through gene amplification, retroviral integration, or chromosomal translocation. Human FOXN6 mRNA was expressed in breast cancer cell line and primary breast cancer.
Molecular Weight 34kDa
Gene ID 139628
NCBI Accession NP_940853, NM_198451
UniProt Q6PJQ5
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FOXR2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Katoh, Katoh: "Identification and characterization of human FOXK1 gene in silico." in: International journal of molecular medicine, Vol. 14, Issue 1, pp. 127-32, 2004 (PubMed).

Alternatives for antigen "Forkhead Box R2 (FOXR2)", type "Antibodies"
Hosts (3), (2)
Reactivities (5)
Applications (5), (3), (3), (3), (2)
Epitopes (1), (1)
Beacon