Did you know that you can buy products from over 140 different suppliers from us?

Forkhead Box R2 (FOXR2) (N-Term) antibody

Details for Product No. ABIN310396
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RGD1564437, FOXR2, FOXN6, EG436240, Foxn6
Epitope
N-Term
(7), (1), (1)
Reactivity
Human
(12)
Host
Rabbit
(10), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(12), (8), (8), (6), (3), (2), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310396
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FOXR2
Sequence VDPNILCPLGSQEAPKPSGKEDLTNISPFPQPPQKDEGSN CSEDKVVESL
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against FOXR2. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name FOXR2
Background Forkhead-box (FOX) transcription factors are implicated in carcinogenesis through gene amplification, retroviral integration, or chromosomal translocation. Human FOXN6 mRNA was expressed in breast cancer cell line and primary breast cancer.
Molecular Weight 34 kDa
Gene ID 139628
NCBI Accession NM_198451, NP_940853
UniProt Q6PJQ5
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 311 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Forkhead Box R2 (FOXR2) (N-Term) antibody WB Suggested Anti-FOXR2 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
anti-Forkhead Box R2 (FOXR2) (N-Term) antibody (2) WB Suggested Anti-FOXR2
Antibody Titration: 1.25 µg/mL
Positive Control: Jurkat cell lysate
Background publications Katoh, Katoh: "Identification and characterization of human FOXK1 gene in silico." in: International journal of molecular medicine, Vol. 14, Issue 1, pp. 127-32, 2004 (PubMed).

Validation Images
back to top