Transcription Factor 7-Like 1 (T-Cell Specific, HMG-Box) (TCF7L1) (N-Term) antibody

Details for Product No. ABIN404738
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms TCF3, TCF-3, Tcf-3, Tcf3, bHLHb21, tcf3c, tcf3d, xtcf3
Epitope
N-Term
(8), (6), (3), (1), (1), (1)
Reactivity
Human
(22), (13), (3)
Host
Rabbit
(20), (1), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(22), (13), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN404738
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TCF7L1
Sequence NDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSLVNESE NQSSSSDSEA
Predicted Reactivity Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against TCF7L1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TCF7L1
Background TCF7L1 participates in the Wnt signaling pathway. It binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. It is necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis. TCF7L1 down-regulates NQO1, leading to increased mitomycin c resistance.
Molecular Weight 63 kDa
Gene ID 83439
NCBI Accession NM_031283, NP_112573
UniProt Q9HCS4
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Transcription Factors, Wnt
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 588 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transcription Factor 7-Like 1 (T-Cell Specific, HMG-Box) (TCF7L1) (N-Term) antibody WB Suggested Anti-TCF7L1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
anti-Transcription Factor 7-Like 1 (T-Cell Specific, HMG-Box) (TCF7L1) (N-Term) antibody (2) anti-Transcription Factor 7-Like 1 (T-Cell Specific, HMG-Box) (TCF7L1) (N-Term) antibody (Image 2)
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4...." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Hosts (20), (1), (1)
Reactivities (22), (13), (3)
Applications (22), (13), (2), (2)
Epitopes (8), (6), (3), (1), (1), (1)
back to top