Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN404738

Transcription Factor 7-Like 1 (T-Cell Specific, HMG-Box) (TCF7L1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TCF3, TCF-3, Tcf-3, Tcf3, bHLHb21, tcf3c, tcf3d, xtcf3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN404738
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1
Sequence NDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSLVNESE NQSSSSDSEA
Predicted Reactivity Guinea pig : 100%, Human : 100%, Mouse : 100%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against TCF7L1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TCF7L1
Background TCF7L1 participates in the Wnt signaling pathway. It binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. It is necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis. TCF7L1 down-regulates NQO1, leading to increased mitomycin c resistance.
Molecular Weight 63kDa
Gene ID 83439
NCBI Accession NP_112573, NM_031283
UniProt Q9HCS4
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Transcription Factors, Wnt Signaling, Wnt
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TCF7L1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives for antigen "Transcription Factor 7-Like 1 (T-Cell Specific, HMG-Box) (TCF7L1)", type "Antibodies"
Hosts (17), (1), (1)
Reactivities (19), (12), (3)
Applications (19), (13), (2), (2)
Epitopes (7), (6), (2), (1), (1)
Beacon