Did you know that you can buy products from over 140 different suppliers from us?

Claudin 18 (CLDN18) (Middle Region) antibody

Details for Product No. ABIN404887
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SFTA5, SFTPJ, claudin-18, CLDN18
Epitope
Middle Region
(12), (8), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Human
(19), (5), (4), (1), (1), (1)
Host
Rabbit
(22), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(23), (10), (10), (3), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN404887
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CLDN18
Sequence YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE VQSYPSKHDY
Predicted Reactivity Human : 100 %, Mouse : 90 %, Rabbit : 80 %, Rat : 80 %, Dog : 70 %, Pig : 70 %
Characteristics This is a rabbit polyclonal antibody against CLDN18. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CLDN18
Background CLDN18 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells (Niimi et al., 2001 [PubMed 11585919]).
Molecular Weight 28 kDa
Gene ID 51208
NCBI Accession NM_016369, NP_057453
UniProt P56856
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 261 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Karanjawala, Illei, Ashfaq et al.: "New markers of pancreatic cancer identified through differential gene expression analyses: claudin 18 and annexin A8." in: The American journal of surgical pathology, Vol. 32, Issue 2, pp. 188-96, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN404887
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top