Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405355

Exosome Component 2 (EXOSC2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms p7, RRP4, Rrp4p, hRrp4p, Rrp4, fa97b01, wu:fa97b01, zgc:110117, EXOSC2, exosc2, MGC97533
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405355
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EXOSC2 antibody: synthetic peptide directed towards the middle region of human EXOSC2
Sequence AEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQ KTHFHDLPCG
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rat : 92%, Zebrafish : 92%, African clawed frog : 78%
Characteristics This is a rabbit polyclonal antibody against EXOSC2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name EXOSC2
Background EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3' processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3'-5' exoribonuclease activity.
Molecular Weight 32kDa
Gene ID 23404
NCBI Accession NP_055100, NM_014285
UniProt Q13868
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EXOSC2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: van Dijk, Schilders, Pruijn: "Human cell growth requires a functional cytoplasmic exosome, which is involved in various mRNA decay pathways." in: RNA (New York, N.Y.), Vol. 13, Issue 7, pp. 1027-35, 2007 (PubMed).

Alternatives for antigen "Exosome Component 2 (EXOSC2)", type "Antibodies"
Hosts (10), (9)
Reactivities (16), (3), (3), (2), (1)
Applications (11), (9), (4), (3), (2)
Epitopes (2), (2), (1), (1)
Beacon