Exosome Component 2 (EXOSC2) (Middle Region) antibody

Details for Product No. ABIN405355
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms p7, RRP4, Rrp4p, hRrp4p, Rrp4, fa97b01, wu:fa97b01, zgc:110117, EXOSC2, exosc2, MGC97533
Epitope
Middle Region
(3), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
(20), (4), (4), (2), (1)
Host
Rabbit
(12), (11)
Clonality
Polyclonal
Application
Western Blotting (WB)
(15), (10), (5), (4), (2), (2), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN405355
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human EXOSC2
Sequence AEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQ KTHFHDLPCG
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rat : 90 %, Zebrafish : 90 %, African clawed frog : 70 %
Characteristics This is a rabbit polyclonal antibody against EXOSC2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name EXOSC2
Background EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3' processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3'-5' exoribonuclease activity.
Molecular Weight 32 kDa
Gene ID 23404
NCBI Accession NM_014285, NP_055100
UniProt Q13868
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 293 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Exosome Component 2 (EXOSC2) (Middle Region) antibody WB Suggested Anti-EXOSC2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Product cited in: van Dijk, Schilders, Pruijn: "Human cell growth requires a functional cytoplasmic exosome, which is involved in various mRNA decay pathways." in: RNA (New York, N.Y.), Vol. 13, Issue 7, pp. 1027-35, 2007 (PubMed).

Hosts (12), (11)
Reactivities (20), (4), (4), (2), (1)
Applications (15), (10), (5), (4), (2), (2), (2), (2)
Epitopes (3), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top