Did you know that you can buy products from over 140 different suppliers from us?

Fyn-Related Kinase (FRK) (N-Term) antibody

Details for Product No. ABIN406406
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BSK, GTK, RAK, C85044, BSK/IYK, PTK5, BK2, NGK1, FRK
Epitope
N-Term
(9), (9), (7), (4), (3), (2), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
(78), (32), (23), (12), (11), (11)
Host
Rabbit
(53), (32), (2), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(67), (41), (30), (22), (12), (11), (9), (4), (2), (2)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406406
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FRK
Sequence LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDT LHEGWWFARH
Predicted Reactivity Human : 100 %, Mouse : 100 %, Pig : 100 %, Bovine : 90 %, Guinea pig : 90 %, Rat : 90 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against FRK. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FRK
Background The specific function of FRK is not yet known.The protein encoded by this gene belongs to the TYR family of protein kinases. This tyrosine kinase is a nuclear protein and may function during G1 and S phase of the cell cycle and suppress growth.
Molecular Weight 58 kDa
Gene ID 2444
NCBI Accession NM_002031, NP_002022
UniProt P42685
Research Area Kinases/Phosphatases
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 505 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Fyn-Related Kinase (FRK) (N-Term) antibody WB Suggested Anti-FRK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T
Product cited in: Zhang, Gong, Wang et al.: "[Deoxycholate induces apoptosis in cultured normal human esophageal mucosal epithelial cells]." in: Di 1 jun yi da xue xue bao = Academic journal of the first medical college of PLA, Vol. 25, Issue 10, pp. 1240-3, 2005 (PubMed).

Background publications Zhang, Wolf-Yadlin, Ross et al.: "Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules." in: Molecular & cellular proteomics : MCP, Vol. 4, Issue 9, pp. 1240-50, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406406
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top