Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501287

Chromobox Homolog 7 (CBX7) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1600014J01Rik, AI851678, D15Ertd417e
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501287
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CBX7 antibody: synthetic peptide directed towards the middle region of human CBX7
Sequence ADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAE GFFRDRSGKF
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Chicken : 92%, Dog : 92%, Mouse : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against CBX7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CBX7
Background CBX7 is involved in maintaining the transcriptionally repressive state of genes. Modifies chromatin, rendering it heritably changed in its expressibility. This protein is regulator of cellular lifespan by maintaining the repression of CDKN2A, but not by inducing telomerase activity.
Molecular Weight 28kDa
Gene ID 23492
NCBI Accession NP_783640, NM_175709
UniProt O95931
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CBX7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scott, Gil, Hernando et al.: "Role of the chromobox protein CBX7 in lymphomagenesis." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 104, Issue 13, pp. 5389-94, 2007 (PubMed).

Alternatives for antigen "Chromobox Homolog 7 (CBX7)", type "Antibodies"
Hosts (4), (1)
Reactivities (5)
Applications (5), (1), (1)
Epitopes (1), (1)
Beacon