Did you know that you can buy products from over 140 different suppliers from us?

Chromobox Homolog 7 (CBX7) (Middle Region) antibody

Details for Product No. ABIN501287
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1600014J01Rik, AI851678, D15Ertd417e
Epitope
Middle Region
(3), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(9), (1)
Host
Rabbit
(6), (2), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (2), (2), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501287
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CBX7
Sequence ADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAE GFFRDRSGKF
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Chicken : 90 %, Dog : 90 %, Mouse : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against CBX7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CBX7
Background CBX7 is involved in maintaining the transcriptionally repressive state of genes. Modifies chromatin, rendering it heritably changed in its expressibility. This protein is regulator of cellular lifespan by maintaining the repression of CDKN2A, but not by inducing telomerase activity.
Molecular Weight 28 kDa
Gene ID 23492
NCBI Accession NM_175709, NP_783640
UniProt O95931
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 251 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromobox Homolog 7 (CBX7) (Middle Region) antibody WB Suggested Anti-CBX7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Background publications Scott, Gil, Hernando et al.: "Role of the chromobox protein CBX7 in lymphomagenesis." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 104, Issue 13, pp. 5389-94, 2007 (PubMed).

Validation Images
back to top