Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502747

Golgin B1 (GOLGB1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GCP, GCP372, GOLIM1, 4930428L02Rik, 628101, 6330407A06Rik, AU042952, C130074L01Rik, F730017E11Rik, Gm6840, mKIAA4151, gcp, golim1, giantin
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN502747
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GOLGB1 antibody: synthetic peptide directed towards the N terminal of human GOLGB1
Sequence NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIE KIKHKLQEKE
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Horse : 92%, Rat : 92%, Mouse : 84%
Characteristics This is a rabbit polyclonal antibody against GOLGB1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GOLGB1
Background GOLGB1 may participate in forming intercisternal cross-bridges of the Golgi complex.
Molecular Weight 376kDa
Gene ID 2804
NCBI Accession NP_004478, NM_004487
UniProt Q14789
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GOLGB1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rosing, Ossendorf, Rak et al.: "Giantin interacts with both the small GTPase Rab6 and Rab1." in: Experimental cell research, Vol. 313, Issue 11, pp. 2318-25, 2007 (PubMed).

Alternatives for antigen "Golgin B1 (GOLGB1)", type "Antibodies"
Hosts (9), (4), (2)
Reactivities (11), (4), (2), (1)
Applications (9), (5), (5), (2), (2), (1), (1), (1), (1)
Conjugates (1), (1)
Epitopes (3), (1)
Beacon