Did you know that you can buy products from over 140 different suppliers from us?

Golgin B1 (GOLGB1) (N-Term) antibody

Details for Product No. ABIN502747
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms gcp, golim1, giantin, 4930428L02Rik, 628101, 6330407A06Rik, AU042952, C130074L01Rik, F730017E11Rik, Gm6840, mKIAA4151, GCP, GCP372, GOLIM1
Epitope
N-Term
(2), (2), (1), (1), (1), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Human
(15), (4), (2)
Host
Rabbit
(9), (7), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(12), (5), (5), (4), (2), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502747
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human GOLGB1
Sequence NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIE KIKHKLQEKE
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Horse : 90 %, Rat : 90 %, Mouse : 80 %
Characteristics This is a rabbit polyclonal antibody against GOLGB1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GOLGB1
Background GOLGB1 may participate in forming intercisternal cross-bridges of the Golgi complex.
Molecular Weight 376 kDa
Gene ID 2804
NCBI Accession NM_004487, NP_004478
UniProt Q14789
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 3259 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Golgin B1 (GOLGB1) (N-Term) antibody WB Suggested Anti-GOLGB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: 721_B cell lysate
anti-Golgin B1 (GOLGB1) (N-Term) antibody (2) Immunohistochemistry with Uterus tissue at an antibody concentration of 5µg/ml using anti-GOLGB1 antibody (ARP46464_P050)
Background publications Rosing, Ossendorf, Rak et al.: "Giantin interacts with both the small GTPase Rab6 and Rab1." in: Experimental cell research, Vol. 313, Issue 11, pp. 2318-25, 2007 (PubMed).

Validation Images
back to top