Golgin B1 (GOLGB1) (N-Term) antibody

Catalog No. ABIN635428

Product Details

Target: Golgin B1 (GOLGB1)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: GOLGB1 antibody was raised against the N terminal of GOLGB1

Purification: Affinity purified

Immunogen: GOLGB1 antibody was raised using the N terminal of GOLGB1 corresponding to a region with amino acids NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GOLGB1 Blocking Peptide, catalog no. 33R-6750, is also available for use as a blocking control in assays to test for specificity of this GOLGB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOLGB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Golgin B1 (GOLGB1)

Alternative Name: GOLGB1 (GOLGB1 Products)

Synonyms: gcp antibody, golim1 antibody, giantin antibody, 4930428L02Rik antibody, 628101 antibody, 6330407A06Rik antibody, AU042952 antibody, C130074L01Rik antibody, F730017E11Rik antibody, Gm6840 antibody, mKIAA4151 antibody, GCP antibody, GCP372 antibody, GOLIM1 antibody, golgin B1 antibody, golgin B1 S homeolog antibody, golgi autoantigen, golgin subfamily b, macrogolgin 1 antibody, GOLGB1 antibody, golgb1.S antibody, Golgb1 antibody

Background: GOLGB1 may participate in forming intercisternal cross-bridges of the Golgi complex.

Molecular Weight: 376 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome