Sad1 and UNC84 Domain Containing 2 (SUN2) (N-Term) antibody

Details for Product No. ABIN502807
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms UNC84B, B230369L08Rik, C030011B15, Unc84b, RGD1563141
Epitope
N-Term
(2), (2), (2), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Human
(7), (2), (1), (1), (1)
Host
Rabbit
(10)
Clonality
Polyclonal
Application
Western Blotting (WB)
(10), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN502807
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human UNC84B
Sequence SRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAE FSSNWQKEAM
Predicted Reactivity Rat :100 %,   Human :100 %,   Bovine :90 %,   Dog :90 %,   Mouse :90 %,  
Characteristics This is a rabbit polyclonal antibody against UNC84B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name UNC84B
Background UNC84B may form a physical interaction between the nuclear envelope and the centrosome.
Molecular Weight 80 kDa
Gene ID 25777
NCBI Accession NM_015374, NP_056189
UniProt Q9UH99
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 717 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Sad1 and UNC84 Domain Containing 2 (SUN2) (N-Term) antibody WB Suggested Anti-UNC84B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate
Background publications Cerhan, Ansell, Fredericksen et al.: "Genetic variation in 1253 immune and inflammation genes and risk of non-Hodgkin lymphoma." in: Blood, Vol. 110, Issue 13, pp. 4455-63, 2007 (PubMed).

Hosts (10)
Reactivities (7), (2), (1), (1), (1)
Applications (10), (2), (2), (1), (1)
Epitopes (2), (2), (2), (1), (1)
back to top