Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502807

Sad1 and UNC84 Domain Containing 2 (SUN2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms UNC84B, B230369L08Rik, C030011B15, Unc84b, RGD1563141
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502807
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-UNC84B antibody: synthetic peptide directed towards the N terminal of human UNC84B
Sequence SRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAE FSSNWQKEAM
Predicted Reactivity Rat :100%,   Human :100%,   Bovine :92%,   Dog :92%,   Mouse :92%,  
Characteristics This is a rabbit polyclonal antibody against UNC84B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name UNC84B
Background UNC84B may form a physical interaction between the nuclear envelope and the centrosome.
Molecular Weight 80kDa
Gene ID 25777
NCBI Accession NP_056189, NM_015374
UniProt Q9UH99
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-UNC84B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Cerhan, Ansell, Fredericksen et al.: "Genetic variation in 1253 immune and inflammation genes and risk of non-Hodgkin lymphoma." in: Blood, Vol. 110, Issue 13, pp. 4455-63, 2007 (PubMed).

Alternatives for antigen "Sad1 and UNC84 Domain Containing 2 (SUN2)", type "Antibodies"
Hosts (12)
Reactivities (9), (2), (1), (1), (1)
Applications (12), (4), (2), (1)
Epitopes (2), (2), (2), (2), (1), (1), (1), (1)
Beacon