Eukaryotic Translation Initiation Factor 3, Subunit L (EIF3L) (N-Term) antibody

Details for Product No. ABIN502936
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EIF3EIP, EIF3S11, HSPC021, HSPC025, MSTP005, EIF3S6IP, 0610011H21Rik, D15N1e, Eif3eip, Eif3ip, Eif3s6ip, HSP-66Y, PAF67, eif3eip, eif3s6ip
Epitope
N-Term
(3), (3), (2), (1)
Reactivity
Mouse (Murine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(5), (2)
Host
Rabbit
(8)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN502936
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human EIF3EIP
Sequence SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYE QQTYQVIPEV
Predicted Reactivity Chicken : 100 %, Human : 100 %
Characteristics This is a rabbit polyclonal antibody against EIF3EIP. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name EIF3EIP
Background EIF3EIP belongs to the EIF3EIP family. It interacts with EIF3E. EIF3EIP interacts with Int-6 and is associated with eukaryotic translation initiation factor 3.
Molecular Weight 67 kDa
Gene ID 51386
NCBI Accession NM_016091, NP_057175
UniProt Q9Y262
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 564 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Eukaryotic Translation Initiation Factor 3, Subunit L (EIF3L) (N-Term) antibody WB Suggested Anti-EIF3EIP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (8)
Reactivities (5), (2)
Applications (8), (2), (1)
Epitopes (3), (3), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top