Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502936

Eukaryotic Translation Initiation Factor 3, Subunit L (EIF3L) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EIF3EIP, EIF3S11, HSPC021, HSPC025, MSTP005, EIF3S6IP, 0610011H21Rik, D15N1e, Eif3eip, Eif3ip, Eif3s6ip, HSP-66Y, PAF67, eif3eip, eif3s6ip
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502936
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EIF3EIP antibody: synthetic peptide directed towards the N terminal of human EIF3EIP
Sequence SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYE QQTYQVIPEV
Predicted Reactivity Chicken : 100%, Human : 100%
Characteristics This is a rabbit polyclonal antibody against EIF3EIP. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name EIF3EIP
Background EIF3EIP belongs to the EIF3EIP family. It interacts with EIF3E. EIF3EIP interacts with Int-6 and is associated with eukaryotic translation initiation factor 3.
Molecular Weight 67kDa
Gene ID 51386
NCBI Accession NP_057175, NM_016091
UniProt Q9Y262
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EIF3EIP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Eukaryotic Translation Initiation Factor 3, Subunit L (EIF3L)", type "Antibodies"
Hosts (7)
Reactivities (5), (2)
Applications (7), (2), (2)
Epitopes (4), (2), (2)
Beacon