Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503134

Sialic Acid Binding Ig-Like Lectin 10 (SIGLEC10) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PRO940, SIGLEC-10, SLG2, Siglec-G, Siglec10, mSiglec-G, 9830164H23, A630096C01Rik, Siglecg, SIGLEC10, slg2, pro940, siglec-10
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503134
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SIGLEC10 antibody: synthetic peptide directed towards the middle region of human SIGLEC10
Sequence CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALE PQPQGNVPYL
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against SIGLEC10. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SIGLEC10
Background SIGLEC10 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. SIGLEC10 preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, SIGLEC10 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.SIGLECs are members of the immunoglobulin superfamily that are expressed on the cell surface. Most SIGLECs have 1 or more cytoplasmic immune receptor tyrosine-based inhibitory motifs, or ITIMs. SIGLECs are typically expressed on cells of the innate immune system, with the exception of the B-cell expressed SIGLEC6 (MIM 604405).
Molecular Weight 76kDa
Gene ID 89790
NCBI Accession NP_149121, NM_033130
UniProt Q96LC7
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SIGLEC10 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Szafranski, Schindler, Taudien et al.: "Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns." in: Genome biology, Vol. 8, Issue 8, pp. R154, 2008 (PubMed).

Alternatives for antigen "Sialic Acid Binding Ig-Like Lectin 10 (SIGLEC10)", type "Antibodies"
Hosts (32), (4)
Reactivities (35), (17), (17), (17), (17)
Applications (18), (15), (11), (10), (6), (4), (4), (2), (2)
Conjugates (4), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (2), (2), (2), (2), (1), (1)
Beacon