Did you know that you can buy products from over 140 different suppliers from us?

Sialic Acid Binding Ig-Like Lectin 10 (SIGLEC10) (Middle Region) antibody

Details for Product No. ABIN503134
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PRO940, SIGLEC-10, SLG2, Siglec-G, Siglec10, mSiglec-G, 9830164H23, A630096C01Rik, Siglecg, SIGLEC10, slg2, pro940, siglec-10
Epitope
Middle Region
(12), (7), (2), (2), (1)
Reactivity
Human
(43), (17), (17), (17), (17)
Host
Rabbit
(39), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(6), (5), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(27), (23), (17), (14), (6), (5), (4), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503134
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SIGLEC10
Sequence CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALE PQPQGNVPYL
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against SIGLEC10. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SIGLEC10
Background SIGLEC10 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. SIGLEC10 preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, SIGLEC10 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.SIGLECs are members of the immunoglobulin superfamily that are expressed on the cell surface. Most SIGLECs have 1 or more cytoplasmic immune receptor tyrosine-based inhibitory motifs, or ITIMs. SIGLECs are typically expressed on cells of the innate immune system, with the exception of the B-cell expressed SIGLEC6 (MIM 604405).
Molecular Weight 76 kDa
Gene ID 89790
NCBI Accession NM_033130, NP_149121
UniProt Q96LC7
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 697 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Sialic Acid Binding Ig-Like Lectin 10 (SIGLEC10) (Middle Region) antibody WB Suggested Anti-SIGLEC10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: OVCAR-3 cell lysate
Product cited in: Szafranski, Schindler, Taudien et al.: "Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns." in: Genome biology, Vol. 8, Issue 8, pp. R154, 2008 (PubMed).

Hosts (39), (5)
Reactivities (43), (17), (17), (17), (17)
Applications (27), (23), (17), (14), (6), (5), (4), (3), (2)
Conjugates (6), (5), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (12), (7), (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503134
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top