Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503788

TBC1 Domain Family, Member 10C (TBC1D10C) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CARABIN, EPI64C, AI428527, 1810062O14Rik, RGD1311490
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503788
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TBC1D10C antibody: synthetic peptide directed towards the N terminal of human TBC1D10C
Sequence MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRY GFIGGSSAEP
Predicted Reactivity Human : 100%, Dog : 92%, Horse : 92%, Pig : 92%, Bovine : 85%, Rat : 78%
Characteristics This is a rabbit polyclonal antibody against TBC1D10C. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TBC1D10C
Background TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.Carabin is an endogenous inhibitor of calcineurin (see MIM 114105) that also inhibits the Ras (see MIM 190020) signaling pathway through its intrinsic Ras GTPase-activating protein activity (Pan et al., 2007 [PubMed 17230191]).
Molecular Weight 50kDa
Gene ID 374403
NCBI Accession NP_940919, NM_198517
UniProt Q8IV04
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TBC1D10°Cantibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Pan, Sun, Kardian et al.: "Feedback inhibition of calcineurin and Ras by a dual inhibitory protein Carabin." in: Nature, Vol. 445, Issue 7126, pp. 433-6, 2007 (PubMed).

Alternatives for antigen "TBC1 Domain Family, Member 10C (TBC1D10C)", type "Antibodies"
Hosts (34), (5)
Reactivities (32), (18), (4), (2), (1), (1)
Applications (38), (24), (15), (6)
Epitopes (14), (12), (2)
Beacon