Did you know that you can buy products from over 140 different suppliers from us?

MDS1 and EVI1 Complex Locus (MECOM) (C-Term) antibody

Details for Product No. ABIN970646
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AML1-EVI-1, EVI1, MDS1, MDS1-EVI1, PRDM3, D630039M04Rik, Evi-1, Evi1, Jbo, Mds, Mds1, Mds1-Evi1, Prdm3, Znfpr1b1, evi1, im:7140716, prdm3
Epitope
C-Term
(25), (10), (10), (8), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Rat (Rattus), Dog (Canine), Mouse (Murine), Cow (Bovine), Human, Chicken
(62), (8), (2), (1), (1), (1)
Host
Rabbit
(40), (24), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (3), (3), (3)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(61), (31), (3), (3), (2), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN970646
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human EVI1
Sequence HFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRK SKSQAYAMML
Predicted Reactivity Human : 100 %, Mouse : 90 %
Characteristics This is a rabbit polyclonal antibody against EVI1. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name EVI1
Background EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.
Molecular Weight 118 kDa
Gene ID 2122
NCBI Accession NM_005241, NP_005232
UniProt Q03112
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Cell Cycle
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1051 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-MDS1 and EVI1 Complex Locus (MECOM) (C-Term) antibody WB Suggested Anti-EVI1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Lung
anti-MDS1 and EVI1 Complex Locus (MECOM) (C-Term) antibody (2) anti-MDS1 and EVI1 Complex Locus (MECOM) (C-Term) antibody (Image 2)
Background publications Chi, Senyuk, Chakraborty et al.: "EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity." in: The Journal of biological chemistry, Vol. 278, Issue 50, pp. 49806-11, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN970646
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top