Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN970646

MDS1 and EVI1 Complex Locus (MECOM) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AML1-EVI-1, EVI1, MDS1, MDS1-EVI1, PRDM3, D630039M04Rik, Evi-1, Evi1, Jbo, Mds, Mds1, Mds1-Evi1, Prdm3, Znfpr1b1, evi1, im:7140716, prdm3
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rat (Rattus), Dog (Canine), Mouse (Murine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN970646
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the C terminal of human EVI1
Sequence HFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRK SKSQAYAMML
Predicted Reactivity Human : 100%, Mouse : 92%
Characteristics This is a rabbit polyclonal antibody against EVI1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name EVI1
Background EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.
Molecular Weight 118kDa
Gene ID 2122
NCBI Accession NP_005232, NM_005241
UniProt Q03112
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Cell Cycle
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EVI1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Chi, Senyuk, Chakraborty et al.: "EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity." in: The Journal of biological chemistry, Vol. 278, Issue 50, pp. 49806-11, 2003 (PubMed).

Alternatives for antigen "MDS1 and EVI1 Complex Locus (MECOM)", type "Antibodies"
Hosts (26), (17), (2)
Reactivities (41), (10), (1), (1), (1), (1)
Applications (41), (14), (3), (2), (2), (2)
Epitopes (15), (5), (4), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1)
Beacon