Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1046768

Caspase 1, Apoptosis-Related Cysteine Peptidase (Interleukin 1, Beta, Convertase) (CASP1) protein (GST tag)

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Synonyms Ice, Il1bc, ICE, P45, IL1BC, CASP1, CG5370, DCP-1, DCP1, Dcp1, Dmel\\CG5370, ccp1, dcp-1, dcp1, l(2)01862, l(2)02132
Origin
»Alternatives Human
Source
»Alternatives Escherichia coli (E. coli)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 2 references available
Catalog no. ABIN1046768
Quantity 50 µg
Price
242.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 9 to 11 Business Days
Sequence NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKS SRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYS VDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGI REGICGKKHSEQVPDILQLNAIFNMLNTKN
Characteristics Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis.
Purity 90%
Alternative Name Caspase-1
Background Synonyms: CASP-1,Interleukin-1 beta convertase,IL-1BC,Interleukin-1 beta-converting enzyme,ICE,IL-1 beta-converting enzyme,p45
Molecular Weight 43 kDa
Research Area Apoptosis/Necrosis
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Product cited in: Cerretti, Kozlosky, Mosley et al.: "Molecular cloning of the interleukin-1 beta converting enzyme." in: Science (New York, N.Y.), Vol. 256, Issue 5053, pp. 97-100, 1992 (PubMed).

Miller, Ayala, Egger et al.: "Purification and characterization of active human interleukin-1 beta-converting enzyme from THP.1 monocytic cells." in: The Journal of biological chemistry, Vol. 268, Issue 24, pp. 18062-9, 1993 (PubMed).

Alternatives for antigen "Caspase 1, Apoptosis-Related Cysteine Peptidase (Interleukin 1, Beta, Convertase) (CASP1)", type "Proteins"
Hosts (7), (7), (2)
Reactivities (12), (2), (1), (1), (1), (1), (1), (1)
Beacon