Solute Carrier Family 22 (Organic Cation Transporter), Member 1 (SLC22A1) antibody

Details for Product No. ABIN2361653
Antigen
  • SLC22A1
  • OCT1
  • HOCT1
  • oct1_cds
  • Lx1
  • Oct1
  • Orct
  • Orct1
  • Roct1
  • SLC22A2
  • solute carrier family 22 member 1
  • solute carrier family 22 (organic cation transporter), member 1
  • solute carrier family 22 member 2-like
  • SLC22A1
  • Slc22a1
  • LOC421584
Reactivity
Human
90
15
11
5
4
3
2
2
2
1
1
Host
Rabbit
66
24
1
Clonality
Polyclonal
Conjugate
Un-conjugated
6
4
3
2
2
2
2
2
2
2
2
2
Application
Immunohistochemistry (IHC), Western Blotting (WB)
74
43
35
13
8
3
2
1
1
Options
Immunogen Synthetic peptide corresponding to IAIQMICLVNAELYPTFVSGVGPACRGSDATSSRDQGGRFARDHEGRREP
Sequence IAIQMICLVN AELYPTFVSG VGPACRGSDA TSSRDQGGRF ARDHEGRREP
Cross-Reactivity Human
Cross-Reactivity (Details) Calculated cross reactivity: Hu
Characteristics SLC22A1 (OCT1, Solute Carrier Family 22 Member 1, Organic Cation Transporter 1, HOCT1)
Purification Purified by Protein A affinity chromatography.
Antigen
Alternative Name SLC22A1 (SLC22A1 Antibody Abstract)
Pathways Hormone Transport
Application Notes Optimal working conditions should be determined by the investigator.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Reconstitute with 100 μL dH2O to 1 mg/mL.
Buffer Supplied as a lyophilized powder in PBS.
Storage -20 °C
Storage Comment -20°C
Did you look for something else?