Neuropeptide FF-Amide Peptide Precursor (NPFF) (AA 1-116) antibody

Details for Product No. ABIN2565727
Antigen
  • FMRFAL
  • neuropeptide FF-amide peptide precursor
  • NPFF
  • Npff
Epitope
AA 1-116
10
9
7
1
Reactivity
Human
40
18
15
Host
Mouse
43
Clonality (Clone)
Monoclonal ()
Conjugate
Un-conjugated
5
5
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
27
17
15
13
3
2
Options
Purpose Mouse monoclonal antibody raised against a full-length recombinant NPFF.
Immunogen

immunogen: NPFF (AAI04235.1, 1 a.a. ~ 116 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MVPQPPTTCPWKPVPSPCDLRVQGICPSSFPDTPLAQEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK

Clone 7F12
Isotype IgG2a kappa
Cross-Reactivity Human
Antigen
Alternative Name NPFF (NPFF Antibody Abstract)
Background Full Gene Name: neuropeptide FF-amide peptide precursor
Synonyms: FMRFAL
Gene ID 8620
Pathways Hormone Transport, Negative Regulation of Hormone Secretion, Synaptic Membrane
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Neuropeptide FF-Amide Peptide Precursor (NPFF) (AA 1-116) antibody (ABIN2565727) Western Blot detection against Immunogen (39.4 KDa) .
Did you look for something else?