APLP1 antibody (N-Term)
-
- Target See all APLP1 Antibodies
- APLP1 (Amyloid beta (A4) Precursor-Like Protein 1 (APLP1))
-
Binding Specificity
- AA 82-112, N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APLP1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Amyloid-like protein 1(APLP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- RRCLRDPQRV LEYCRQMYPE LQIARVEQAT Q
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Amyloid-like protein 1(APLP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: amyloid beta (A4) precursor-like protein 1
Protein Name: Amyloid-like protein 1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human APLP1 (82-112aa RRCLRDPQRVLEYCRQMYPELQIARVEQATQ), different from the related mouse sequence by three amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product APLP1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- APLP1 (Amyloid beta (A4) Precursor-Like Protein 1 (APLP1))
- Alternative Name
- APLP1 (APLP1 Products)
- Background
-
Amyloid-precursor-like protein 1 (APLP1) is a membrane-associated glycoprotein, whose gene is homologous to the APP gene, which has been shown to be involved in the pathogenesis of Alzheimer's disease. APLP1 is predominantly expressed in brain, particularly in the cerebral cortex postsynaptic density. The human gene has been mapped to chromosomal region 19q13.1. The gene is 11.8 kb long and contains 17 exons. APLP1 has been considered a candidate gene for CNF. All exon regions of the gene were amplified by the polymerase chain reaction and sequenced from DNA of CNF patients. No differences were observed between CNF patients and controls, suggesting that mutations in APLP1 are not involved in the etiology of CNF.
Synonyms: AMYLOID BETA A4 PRECURSOR-LIKE PROTEIN 1 antibody|AMYLOID PRECURSOR-LIKE PROTEIN antibody| Amyloid-like protein 1 precursor antibody|APLP 1 antibody|APLP antibody|APLP-1 antibody| Aplp1 antibody|APLP1_HUMAN antibody|C30 antibody - Gene ID
- 333
- UniProt
- P51693
- Pathways
- cAMP Metabolic Process
-