Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

GABRG2 antibody (gamma-aminobutyric Acid (GABA) A Receptor, gamma 2) Primary Antibody

GABRG2 Reactivity: Human, Mouse, Rat, Dog WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN630118
$552.32
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    GABRG2
    Reactivity
    • 59
    • 45
    • 45
    • 21
    • 11
    • 9
    • 6
    • 5
    • 5
    • 5
    • 3
    • 3
    • 2
    • 2
    Human, Mouse, Rat, Dog
    Host
    • 59
    • 9
    • 1
    Rabbit
    Clonality
    • 68
    • 1
    Polyclonal
    Conjugate
    • 35
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This GABRG2 antibody is un-conjugated
    Application
    • 56
    • 34
    • 20
    • 14
    • 14
    • 7
    • 6
    • 4
    • 3
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Purification
    Purified
    Immunogen
    GABRG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR
  • Application Notes
    WB: 1.25 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    GABRG2 Blocking Peptide, catalog no. 33R-1384, is also available for use as a blocking control in assays to test for specificity of this GABRG2 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRG2 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    GABRG2
    Alternative Name
    GABRG2 (GABRG2 Antibody Abstract)
    Synonyms
    cae2, eca2, gabrg1, gefsp3, si:ch211-145n14.1, CAE2, ECA2, GEFSP3, GABAA-R, Gabrg-2, gamma2, gamma-aminobutyric acid type A receptor gamma2 subunit, gamma-aminobutyric acid (GABA) A receptor, gamma 2, gamma-aminobutyric acid type A receptor gamma 2 subunit, gamma-aminobutyric acid (GABA) A receptor, subunit gamma 2, GABRG2, gabrg2, Gabrg2
    Background
    Gamma-aminobutyric acid (GABA), the major inhibitory neurotransmitter in the brain, mediates neuronal inhibition by binding to GABA receptors. The type A GABA receptors are pentameric chloride channels assembled from among many genetic variants of GABA(A) subunits. GABRG2 is the gamma 2 subunit of GABA(A) receptor. Mutations in this gene have been associated with epilepsy and febrile seizures.
    Molecular Weight
    36 kDa (MW of target protein)
You are here:
help Support