ATP6V1C1 antibody (N-Term)
-
- Target See all ATP6V1C1 Antibodies
- ATP6V1C1 (ATPase, H+ Transporting, Lysosomal 42kDa, V1 Subunit C1 (ATP6V1C1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP6V1C1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ATP6 V6 1 antibody was raised against the N terminal of ATP6 6 1
- Purification
- Affinity purified
- Immunogen
- ATP6 V6 1 antibody was raised using the N terminal of ATP6 6 1 corresponding to a region with amino acids MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNG
- Top Product
- Discover our top product ATP6V1C1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATP6V1C1 Blocking Peptide, catalog no. 33R-6113, is also available for use as a blocking control in assays to test for specificity of this ATP6V1C1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP6V1C1 (ATPase, H+ Transporting, Lysosomal 42kDa, V1 Subunit C1 (ATP6V1C1))
- Alternative Name
- ATP6V1C1 (ATP6V1C1 Products)
- Background
- ATP6V1C1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation.
- Molecular Weight
- 42 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Proton Transport
-