NSUN4 antibody (NOL1/NOP2/Sun Domain Family, Member 4) (N-Term) Primary Antibody
NSUN4
Reactivity: Human
WB
Host: Rabbit
Polyclonal
camera_alt 1
Catalog No. ABIN631550
$647.32
Plus shipping costs $45.00
50 μg
local_shipping
Shipping to:
United States
Delivery in 9 to 11 Business Days
-
- Target
- Binding Specificity
- N-Term
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Conjugate
- This NSUN4 antibody is un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- NSUN4 antibody was raised against the N terminal of NSUN4
- Purification
- Affinity purified
- Immunogen
- NSUN4 antibody was raised using the N terminal of NSUN4 corresponding to a region with amino acids QKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQSEGGQSAAPSP
-
-
- Application Notes
- WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
NSUN4 Blocking Peptide, catalog no. 33R-7616, is also available for use as a blocking control in assays to test for specificity of this NSUN4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Alternative Name
- NSUN4 (NSUN4 Antibody Abstract)
- Background
- NSUN4 may have S-adenosyl-L-methionine-dependent methyl-transferase activity.
- Molecular Weight
- 43 kDa (MW of target protein)
You are here: