Nop10 antibody (NOP10 Ribonucleoprotein Homolog (Yeast)) (Middle Region)

Details for Product anti-Nop10 Antibody No. ABIN631878
Antigen
Epitope
Middle Region
5
1
1
Reactivity
Human
7
2
2
2
2
2
1
1
1
1
1
1
1
Host
Rabbit
6
1
Clonality
Polyclonal
Conjugate
This Nop10 antibody is un-conjugated
1
1
1
Application
Western Blotting (WB)
5
4
1
Options
Immunogen NOLA3 antibody was raised using the middle region of Nola3 corresponding to a region with amino acids MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK
Specificity NOLA3 antibody was raised against the middle region of Nola3
Purification Affinity purified
Antigen
Alternative Name NOLA3 (Nop10 Antibody Abstract)
Background This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA.
Molecular Weight 8 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

NOLA3 Blocking Peptide, catalog no. 33R-5997, is also available for use as a blocking control in assays to test for specificity of this NOLA3 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOLA3 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-NOP10 Ribonucleoprotein Homolog (Yeast) (Nop10) (Middle Region) antibody (ABIN631878) NOLA3 antibody used at 1 ug/ml to detect target protein.