Pleckstrin Homology Domain Containing, Family O Member 1 (PLEKHO1) (N-Term) antibody

Details for Product No. ABIN633055
Antigen
Epitope
N-Term
15
10
5
5
4
4
2
2
Reactivity
Human
57
36
29
1
1
1
Host
Rabbit
51
6
Clonality
Polyclonal
Conjugate
Un-conjugated
3
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
30
25
13
13
9
4
4
2
1
Options
Immunogen PLEKHO1 antibody was raised using the N terminal of PLEKHO1 corresponding to a region with amino acids MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKG
Specificity PLEKHO1 antibody was raised against the N terminal of PLEKHO1
Purification Affinity purified
Antigen
Alternative Name PLEKHO1 (PLEKHO1 Antibody Abstract)
Background PLEKHO1 plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP).PLEKHO1 may function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). PLEKHO1 appears to target ATM to the plasma membrane. PLEKHO1 appears to also inhibit tumor cell growth by inhibiting AKT-mediated cell-survival. PLEKHO1 is also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation.
Molecular Weight 46 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

PLEKHO1 Blocking Peptide, catalog no. 33R-6233, is also available for use as a blocking control in assays to test for specificity of this PLEKHO1 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLEKHO1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Pleckstrin Homology Domain Containing, Family O Member 1 (PLEKHO1) (N-Term) antibody (ABIN633055) PLEKHO1 antibody used at 1 ug/ml to detect target protein.