IL22 Receptor alpha 1 antibody (Middle Region)
-
- Target See all IL22 Receptor alpha 1 (IL22RA1) Antibodies
- IL22 Receptor alpha 1 (IL22RA1) (Interleukin 22 Receptor, alpha 1 (IL22RA1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IL22 Receptor alpha 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IL22 R alpha 1 antibody was raised against the middle region of IL22 A1
- Purification
- Affinity purified
- Immunogen
- IL22 R alpha 1 antibody was raised using the middle region of IL22 A1 corresponding to a region with amino acids YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ
- Top Product
- Discover our top product IL22RA1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IL22R alpha 1 Blocking Peptide, catalog no. 33R-10235, is also available for use as a blocking control in assays to test for specificity of this IL22R alpha 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL20 A1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL22 Receptor alpha 1 (IL22RA1) (Interleukin 22 Receptor, alpha 1 (IL22RA1))
- Alternative Name
- IL22R alpha 1 (IL22RA1 Products)
- Background
- IL22RA1 belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CRFB4).
- Molecular Weight
- 63 kDa (MW of target protein)
-