IL22 Receptor alpha 1 antibody (Interleukin 22 Receptor, alpha 1) (Middle Region)

Details for Product anti-IL22RA1 Antibody No. ABIN634946
Antigen
Epitope
Middle Region
16
11
6
5
4
3
3
2
2
2
1
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine)
85
30
26
4
4
3
3
2
2
2
2
1
Host
Rabbit
76
7
2
2
Clonality
Polyclonal
Conjugate
This IL22 Receptor alpha 1 antibody is un-conjugated
5
4
4
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
58
34
13
11
7
6
4
4
3
1
Options
Immunogen IL22 R alpha 1 antibody was raised using the middle region of IL22 A1 corresponding to a region with amino acids YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ
Specificity IL22 R alpha 1 antibody was raised against the middle region of IL22 A1
Purification Affinity purified
Antigen
Alternative Name IL22R alpha 1 (IL22RA1 Antibody Abstract)
Background IL22RA1 belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CRFB4).
Molecular Weight 63 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

IL22R alpha 1 Blocking Peptide, catalog no. 33R-10235, is also available for use as a blocking control in assays to test for specificity of this IL22R alpha 1 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL20 A1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Interleukin 22 Receptor, alpha 1 (IL22RA1) (Middle Region) antibody (ABIN634946) IL22R alpha 1 antibody used at 1 ug/ml to detect target protein.