NBC4 antibody (Middle Region)

Catalog No. ABIN635011

Product Details anti-NBC4 Antibody

Target: NBC4 (Electrogenic Sodium Bicarbonate Cotransporter 4 (NBC4))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NBC4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC4 A5 antibody was raised against the middle region of SLC4 5

Purification: Affinity purified

Immunogen: SLC4 A5 antibody was raised using the middle region of SLC4 5 corresponding to a region with amino acids SIAHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC4A5 Blocking Peptide, catalog no. 33R-8521, is also available for use as a blocking control in assays to test for specificity of this SLC4A5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NBC4

Target: NBC4 (Electrogenic Sodium Bicarbonate Cotransporter 4 (NBC4))

Alternative Name: SLC4A5 (NBC4 Products)

Synonyms: NBC4 antibody, solute carrier family 4 member 5 antibody, SLC4A5 antibody, Slc4a5 antibody

Background: This gene encodes a member of the sodium bicarbonate cotransporter (NBC) family, part of the bicarbonate transporter superfamily. Sodium bicarbonate cotransporters are involved in intracellular pH regulation.

Molecular Weight: 126 kDa (MW of target protein)