Dipeptidylpeptidase 10 (DPP10) (Middle Region) antibody

Details for Product No. ABIN635073
Antigen
Epitope
Middle Region
17
13
11
10
8
5
1
1
1
1
1
Reactivity
Human
84
33
20
6
5
5
4
4
3
2
1
1
Host
Rabbit
69
7
7
3
Clonality
Polyclonal
Conjugate
Un-conjugated
5
4
4
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
55
29
22
17
13
6
2
2
Options
Immunogen DPP10 antibody was raised using the middle region of DPP10 corresponding to a region with amino acids VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE
Specificity DPP10 antibody was raised against the middle region of DPP10
Purification Affinity purified
Antigen
Alternative Name DPP10 (DPP10 Antibody Abstract)
Background DPP10 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Mutations in this gene have been associated with asthma.
Molecular Weight 90 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

DPP10 Blocking Peptide, catalog no. 33R-9716, is also available for use as a blocking control in assays to test for specificity of this DPP10 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPP10 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Dipeptidylpeptidase 10 (DPP10) (Middle Region) antibody (ABIN635073) DPP10 antibody used at 1 ug/ml to detect target protein.