STRA6 antibody
-
- Target See all STRA6 Antibodies
- STRA6 (Stimulated By Retinoic Acid 6 (STRA6))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This STRA6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- STRA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG
- Top Product
- Discover our top product STRA6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
STRA6 Blocking Peptide, catalog no. 33R-6506, is also available for use as a blocking control in assays to test for specificity of this STRA6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STRA6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STRA6 (Stimulated By Retinoic Acid 6 (STRA6))
- Alternative Name
- STRA6 (STRA6 Products)
- Synonyms
- MCOPCB8 antibody, MCOPS9 antibody, AI891933 antibody, RGD1307551 antibody, STRA6 antibody, im:7151282 antibody, wu:fc51h06 antibody, zgc:136689 antibody, mcops9 antibody, pp14296 antibody, stimulated by retinoic acid 6 antibody, stimulated by retinoic acid gene 6 antibody, stimulated by retinoic acid gene 6 homolog (mouse) antibody, STRA6 antibody, Stra6 antibody, stra6 antibody
- Background
- STRA6 may act as a high-affinity cell-surface receptor for the complex retinol-retinol binding protein (RBP/RBP4). STRA6 acts by removing retinol from RBP/RBP4 and transports it across the plasma membrane, where it can be metabolized. This mechanism does not depend on endocytosis. STRA6 binds to RBP/RBP4 with high affinity. STRA6 increases cellular retinol uptake from the retinol-RBP complex.
- Molecular Weight
- 73 kDa (MW of target protein)
- Pathways
- Feeding Behaviour
-