STRA6 antibody

Catalog No. ABIN635189

Product Details anti-STRA6 Antibody

Target: STRA6 (Stimulated By Retinoic Acid 6 (STRA6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STRA6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: STRA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STRA6 Blocking Peptide, catalog no. 33R-6506, is also available for use as a blocking control in assays to test for specificity of this STRA6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STRA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STRA6

Target: STRA6 (Stimulated By Retinoic Acid 6 (STRA6))

Alternative Name: STRA6 (STRA6 Products)

Synonyms: MCOPCB8 antibody, MCOPS9 antibody, AI891933 antibody, RGD1307551 antibody, STRA6 antibody, im:7151282 antibody, wu:fc51h06 antibody, zgc:136689 antibody, mcops9 antibody, pp14296 antibody, stimulated by retinoic acid 6 antibody, stimulated by retinoic acid gene 6 antibody, stimulated by retinoic acid gene 6 homolog (mouse) antibody, STRA6 antibody, Stra6 antibody, stra6 antibody

Background: STRA6 may act as a high-affinity cell-surface receptor for the complex retinol-retinol binding protein (RBP/RBP4). STRA6 acts by removing retinol from RBP/RBP4 and transports it across the plasma membrane, where it can be metabolized. This mechanism does not depend on endocytosis. STRA6 binds to RBP/RBP4 with high affinity. STRA6 increases cellular retinol uptake from the retinol-RBP complex.

Molecular Weight: 73 kDa (MW of target protein)

Pathways: Feeding Behaviour