Yip1 Interacting Factor Homolog B (S. Cerevisiae) (YIF1B) antibody

Details for Product No. ABIN635410
Antigen
Reactivity
Human, Mouse (Murine), Rat (Rattus)
25
4
3
2
2
2
2
2
1
1
1
Host
Rabbit
25
Clonality
Polyclonal
Conjugate
Un-conjugated
3
3
3
2
2
2
Application
Western Blotting (WB)
22
19
16
3
1
1
Options
Immunogen YIF1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids LGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVA
Purification Affinity purified
Antigen
Alternative Name YIF1B
Background YIF1B belongs to the YIF1 family. It is a multi-pass membrane protein. The functions of YIF1B remain unknown.
Molecular Weight 31 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

YIF1B Blocking Peptide, catalog no. 33R-4998, is also available for use as a blocking control in assays to test for specificity of this YIF1B antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YIF0 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Yip1 Interacting Factor Homolog B (S. Cerevisiae) (YIF1B) antibody (ABIN635410) YIF1B antibody used at 1 ug/ml to detect target protein.