YIF1B antibody

Catalog No. ABIN635410

Product Details anti-YIF1B Antibody

Target: YIF1B (Yip1 Interacting Factor Homolog B (YIF1B))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This YIF1B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: YIF1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids LGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

YIF1B Blocking Peptide, catalog no. 33R-4998, is also available for use as a blocking control in assays to test for specificity of this YIF1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for YIF1B

Target: YIF1B (Yip1 Interacting Factor Homolog B (YIF1B))

Alternative Name: YIF1B (YIF1B Products)

Synonyms: FinGER8 antibody, MGC83008 antibody, 9430029K10Rik antibody, Yip1b antibody, zgc:103562 antibody, finger8 antibody, MGC76182 antibody, yif1b antibody, Yip1 interacting factor homolog B, membrane trafficking protein S homeolog antibody, Yip1 interacting factor homolog B (S. cerevisiae) antibody, Yip1 interacting factor homolog B, membrane trafficking protein antibody, protein YIF1B antibody, Yip1 interacting factor homolog B, membrane trafficking protein L homeolog antibody, yif1b.S antibody, Yif1b antibody, YIF1B antibody, yif1b antibody, LOC100380764 antibody, yif1b.L antibody

Background: YIF1B belongs to the YIF1 family. It is a multi-pass membrane protein. The functions of YIF1B remain unknown.

Molecular Weight: 31 kDa (MW of target protein)