SNF8 antibody (N-Term)

Catalog No. ABIN1109459

The Rabbit Polyclonal anti-SNF8 antibody has been validated for WB and IHC (p). It is suitable to detect SNF8 in samples from Human, Rat, Mouse, Cow, Dog, Zebrafish (Danio rerio), Xenopus laevis and Chicken.

Quick Overview for SNF8 antibody (N-Term) (ABIN1109459)

Target: SNF8 (Vacuolar-sorting Protein SNF8 (SNF8))

Reactivity: Human, Rat, Mouse, Cow, Dog, Zebrafish (Danio rerio), Xenopus laevis, Chicken

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNF8 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-SNF8 Antibody

Binding Specificity: N-Term

Sequence: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF

Cross-Reactivity (Details): Species reactivity (expected):Mouse, Rat, African clawed frog, Bovine, Dog, Chicken, ZebrafishSpecies reactivity (tested):Human

Purification: Purified on peptide immunoaffinity column

Immunogen: The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Reconstitution: Add 50 μL of distilled water

Handling Advice: Avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store the lyophised antibody at -20 °C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20 °C long term.

Expiry Date: 12 months

Target Details for SNF8

Target: SNF8 (Vacuolar-sorting Protein SNF8 (SNF8))

Alternative Name: Vacuolar-Sorting Protein SNF8

Background: ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25, and VPS36 form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation facto.Synonyms: EAP30, ELL-associated protein of 30 kDa, ESCRT-II complex subunit VPS22

Gene ID: 11267

NCBI Accession: NP_009172