ZNF93 antibody
-
- Target See all ZNF93 Antibodies
- ZNF93 (Zinc Finger Protein 93 (ZNF93))
-
Reactivity
- Human, Cow, Mouse, Rat, Zebrafish (Danio rerio), Xenopus laevis
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZNF93 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Cross-Reactivity (Details)
- Species reactivity (tested):Human, Mouse, Rat, Zebrafish, African clawed frog, Bovine
- Purification
- Purified using peptide immunoaffinity column
- Immunogen
- A synthetic peptide located within the following region of human ZNF93: FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKRIHTGEKPYKC
- Top Product
- Discover our top product ZNF93 Primary Antibody
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Reconstitution
- Add 50 μL of distilled water to a final concentration of 1 mg/mL.
- Concentration
- 1.0 mg/mL after reconstitution
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.
-
- Target
- ZNF93 (Zinc Finger Protein 93 (ZNF93))
- Alternative Name
- ZNF93 (ZNF93 Products)
- Background
- ZNF93 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.Synonyms: HTF34, ZNF505, Zinc finger protein 505, Zinc finger protein 93, Zinc finger protein HTF34
- Molecular Weight
- 71 kDa (620 aa)
- Gene ID
- 81931
- NCBI Accession
- NP_112495
-