ZNF93 antibody

Catalog No. ABIN1449891

Product Details anti-ZNF93 Antibody

Target: ZNF93 (Zinc Finger Protein 93 (ZNF93))

Reactivity: Human, Cow, Mouse, Rat, Zebrafish (Danio rerio), Xenopus laevis

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZNF93 antibody is un-conjugated

Application: Western Blotting (WB)

Cross-Reactivity (Details): Species reactivity (tested):Human, Mouse, Rat, Zebrafish, African clawed frog, Bovine

Purification: Purified using peptide immunoaffinity column

Immunogen: A synthetic peptide located within the following region of human ZNF93: FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKRIHTGEKPYKC

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Reconstitution: Add 50 μL of distilled water to a final concentration of 1 mg/mL.

Concentration: 1.0 mg/mL after reconstitution

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.

Target Details for ZNF93

Target: ZNF93 (Zinc Finger Protein 93 (ZNF93))

Alternative Name: ZNF93 (ZNF93 Products)

Background: ZNF93 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.Synonyms: HTF34, ZNF505, Zinc finger protein 505, Zinc finger protein 93, Zinc finger protein HTF34

Molecular Weight: 71 kDa (620 aa)

Gene ID: 81931

NCBI Accession: NP_112495