Ubiquitin-Conjugating Enzyme E2N (UBE2N) (Middle Region) antibody

Details for Product No. ABIN182924
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms UBC13, AL022654, BB101821, 1500026J17Rik, ube2n, wu:fb11b03, wu:fc08b06, zgc:55726, UbcH-ben, UbcH13, ubc13, ubch-ben, UBE2N, DDBDRAFT_0169154, DDBDRAFT_0237667, DDB_0169154, DDB_0237667
Epitope
Middle Region
(10), (3), (3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Fruit Fly (Drosophila melanogaster), Xenopus laevis, Human, Zebrafish (Danio rerio), Chicken
(43), (25), (25), (13), (12), (12), (2), (1), (1)
Host
Rabbit
(38), (6), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(39), (21), (10), (10), (8), (4), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN182924
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human UBE2N
Sequence VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD PLANDVAEQW
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Sheep : 100 %, Zebrafish : 100 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against UBE2N. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name UBE2N
Background UBE2N encodes a member of the E2 ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.
Molecular Weight 17 kDa
Gene ID 7334
NCBI Accession NM_003348, NP_003339
UniProt P61088
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 152 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ubiquitin-Conjugating Enzyme E2N (UBE2N) (Middle Region) antibody WB Suggested Anti-UBE2N Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
Background publications Bothos, Summers, Venere et al.: "The Chfr mitotic checkpoint protein functions with Ubc13-Mms2 to form Lys63-linked polyubiquitin chains." in: Oncogene, Vol. 22, Issue 46, pp. 7101-7, 2003 (PubMed).

Hosts (38), (6), (4)
Reactivities (43), (25), (25), (13), (12), (12), (2), (1), (1)
Applications (39), (21), (10), (10), (8), (4), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (3), (3), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top