Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182924

Ubiquitin-Conjugating Enzyme E2N (UBE2N) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms UBC13, AL022654, BB101821, 1500026J17Rik, ube2n, wu:fb11b03, wu:fc08b06, zgc:55726, UbcH-ben, UbcH13, ubc13, ubch-ben, UBE2N, DDBDRAFT_0169154, DDBDRAFT_0237667, DDB_0169154, DDB_0237667
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Fruit Fly (Drosophila melanogaster), Xenopus laevis, Human, Zebrafish (Danio rerio), Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182924
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-UBE2N antibody: synthetic peptide directed towards the middle region of human UBE2N
Sequence VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD PLANDVAEQW
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Sheep : 100%, Zebrafish : 100%, Dog : 85%
Characteristics This is a rabbit polyclonal antibody against UBE2N. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name UBE2N
Background UBE2N encodes a member of the E2 ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.
Molecular Weight 17kDa
Gene ID 7334
NCBI Accession NP_003339, NM_003348
UniProt P61088
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-UBE2N antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Bothos, Summers, Venere et al.: "The Chfr mitotic checkpoint protein functions with Ubc13-Mms2 to form Lys63-linked polyubiquitin chains." in: Oncogene, Vol. 22, Issue 46, pp. 7101-7, 2003 (PubMed).

Alternatives for antigen "Ubiquitin-Conjugating Enzyme E2N (UBE2N)", type "Antibodies"
Hosts (38), (6), (5)
Reactivities (44), (25), (25), (14), (13), (13), (3), (2), (1), (1)
Applications (40), (23), (11), (10), (7), (5), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (4), (3), (2), (1), (1)
Beacon