Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183082

Homeobox A1 (HOXA1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BSAS, HOX1, HOX1F, ERA1, Hox-1.6, bsas, hox1f, xhoxa1, hoxa1-A, Xhox.lab, xhox.lab2, HOXA2, HOXA1, hox1, MGC79507
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183082
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HOXA1 antibody: synthetic peptide directed towards the middle region of human HOXA1
Sequence NLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADPPRSLS LPRIGDIFSS
Predicted Reactivity Human : 100%, Bovine : 92%, Dog : 92%, Rabbit : 92%, Guinea pig : 91%, Mouse : 85%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against HOXA1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name HOXA1
Background In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA1 is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development.
Molecular Weight 14kDa
Gene ID 3198
NCBI Accession NP_705873, NM_153620
UniProt P49639-2
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HOXA1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Conciatori, Stodgell, Hyman et al.: "Association between the HOXA1 A218G polymorphism and increased head circumference in patients with autism." in: Biological psychiatry, Vol. 55, Issue 4, pp. 413-9, 2004 (PubMed).

Alternatives for antigen "Homeobox A1 (HOXA1)", type "Antibodies"
Hosts (31), (4), (3)
Reactivities (35), (19), (13), (1), (1)
Applications (37), (16), (4), (3), (2), (1), (1), (1), (1)
Epitopes (6), (5), (4), (3), (2), (2), (2), (1), (1), (1), (1)
Beacon