HOXA1 antibody (Homeobox A1) (AA 1-335)

Details for Product anti-HOXA1 Antibody No. ABIN516595
Antigen
  • BSAS
  • HOX1
  • HOX1F
  • bsas
  • hox1f
  • xhoxa1
  • hoxa1-A
  • Xhox.lab
  • xhox.lab2
  • HOXA1
  • hox1
  • MGC79507
  • ERA1
  • Hox-1.6
  • Xhox.lab2
  • hoxa1
  • homeobox A1
  • homeobox A1 L homeolog
  • homeobox A1 S homeolog
  • homeo box A1
  • HOXA1
  • hoxa1.L
  • hoxa1
  • Hoxa1
  • hoxa1.S
Epitope
AA 1-335
14
11
10
9
9
8
7
7
4
3
3
2
2
1
1
1
Reactivity
Human
104
45
27
4
4
4
3
3
3
1
Host
Mouse
92
7
6
Clonality
Polyclonal
Conjugate
This HOXA1 antibody is un-conjugated
6
5
5
5
5
5
1
1
1
1
1
1
Application
Immunofluorescence (IF), Western Blotting (WB)
90
57
15
9
6
5
2
2
1
1
Options
Purpose Mouse polyclonal antibody raised against a full-length human HOXA1 protein.
Brand MaxPab®
Immunogen

immunogen: HOXA1 (NP_005513.1, 1 a.a. ~ 335 a.a) full-length human protein.

Immunogen Sequence: MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH

Cross-Reactivity Human
Plasmids, Primers & others Plasmids, Primers & others HOXA1 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name HOXA1 (HOXA1 Antibody Abstract)
Background Full Gene Name: homeobox A1
Synonyms: BSAS,HOX1,HOX1F,MGC45232
Gene ID 3198
NCBI Accession NP_005513, NM_005522
Pathways Sensory Perception of Sound
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Homeobox A1 (HOXA1) (AA 1-335) antibody (ABIN516595) Western Blot analysis of HOXA1 expression in transfected 293T cell line by HOXA1 MaxP...
Image no. 2 for anti-Homeobox A1 (HOXA1) (AA 1-335) antibody (ABIN516595) Immunofluorescence of purified MaxPab antibody to HOXA1 on HeLa cell. [antibody conce...
Product cited in: Scott, Nogueira, Heffernan, van Doorn, Dhakal, Hanna, Min, Jaskelioff, Xiao, Wu, Cameron, Perry, Zeid, Feinberg, Kim, Vande Woude, Granter, Bosenberg, Chu, DePinho, Rimm, Chin: "Proinvasion metastasis drivers in early-stage melanoma are oncogenes." in: Cancer cell, Vol. 20, Issue 1, pp. 92-103, 2011 (PubMed).

Did you look for something else?