Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183178

Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BFNC, BFNS1, EBN, EBN1, EIEE7, ENB1, HNSPC, KCNA11, KV7.2, KVEBN1, KQT2, Nmf134
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN183178
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the middle region of human KCNQ2
Sequence GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAH SKELVTAWYI
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against KCNQ2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name KCNQ2
Background The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by the KCNQ2 gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).
Molecular Weight 43kDa
Gene ID 3785
NCBI Accession NP_742107, NM_172109
UniProt Q5VYU0
Research Area Neurology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KCNQ2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Tang, Li, Xia et al.: "A novel mutation in KCNQ2 gene causes benign familial neonatal convulsions in a Chinese family." in: Journal of the neurological sciences, Vol. 221, Issue 1-2, pp. 31-4, 2004 (PubMed).

Background publications Swash, Fox: "The pathology of the human muscle spindle: effect of denervation." in: Journal of the neurological sciences, Vol. 22, Issue 1, pp. 1-24, 1974 (PubMed).

Alternatives for antigen "Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2)", type "Antibodies"
Hosts (41), (7)
Reactivities (40), (25), (24), (19), (18), (3), (3), (3)
Applications (31), (17), (15), (12), (10), (7), (4), (4), (3), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (13), (5), (4), (2)
Beacon