Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2) (Middle Region) antibody

Details for Product No. ABIN183178
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms BFNC, BFNS1, EBN, EBN1, EIEE7, ENB1, HNSPC, KCNA11, KV7.2, KVEBN1, KQT2, Nmf134
Epitope
Middle Region
(14), (4), (4), (2), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Cow (Bovine), Human, Chicken
(40), (26), (25), (19), (18), (3), (3), (3), (2)
Host
Rabbit
(41), (6), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(31), (16), (15), (10), (10), (7), (4), (3), (3), (3), (2)
Pubmed 2 references available
Catalog no. ABIN183178
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human KCNQ2
Sequence GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAH SKELVTAWYI
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against KCNQ2. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name KCNQ2
Background The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by the KCNQ2 gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).
Molecular Weight 43 kDa
Gene ID 3785
NCBI Accession NM_172109, NP_742107
UniProt Q5VYU0
Research Area Neurology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 393 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2) (Middle Region) antibody WB Suggested Anti-KCNQ2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
anti-Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2) (Middle Region) antibody (2) anti-Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2) (Middle Region) antibody (Image 2)
Product cited in: Tang, Li, Xia et al.: "A novel mutation in KCNQ2 gene causes benign familial neonatal convulsions in a Chinese family." in: Journal of the neurological sciences, Vol. 221, Issue 1-2, pp. 31-4, 2004 (PubMed).

Background publications Swash, Fox: "The pathology of the human muscle spindle: effect of denervation." in: Journal of the neurological sciences, Vol. 22, Issue 1, pp. 1-24, 1974 (PubMed).

Hosts (41), (6), (1)
Reactivities (40), (26), (25), (19), (18), (3), (3), (3), (2)
Applications (31), (16), (15), (10), (10), (7), (4), (3), (3), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (14), (4), (4), (2), (1)
back to top