KCNQ2 antibody (Middle Region)

Catalog No. ABIN630098

The Rabbit Polyclonal anti-KCNQ2 antibody is suitable to detect KCNQ2 in samples from Rat, Human, Mouse and Dog. It has been validated for WB and IHC.

Quick Overview for KCNQ2 antibody (Middle Region) (ABIN630098)

Target: KCNQ2 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2))

Reactivity: Rat, Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNQ2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-KCNQ2 Antibody

Binding Specificity: Middle Region

Specificity: KCNQ2 antibody was raised against the middle region of KCNQ2

Purification: Purified

Immunogen: KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNQ2 Blocking Peptide, (ABIN938847), is also available for use as a blocking control in assays to test for specificity of this KCNQ2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNQ2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNQ2

Target: KCNQ2 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2))

Alternative Name: KCNQ2

Background: The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by the KCNQ2 gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).

Molecular Weight: 43 kDa (MW of target protein)