Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183379

Minichromosome Maintenance Complex Component 6 (MCM6) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Mis5, P105MCM, MCG40308, Mcmd6, ASP-l1, D1Wsu22e, CG4039, DmMCM6, DmeMCM6, Dmel\\CG4039, MCM6, McM6, fs(1)K1214, mcm6
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183379
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MCM6 antibody: synthetic peptide directed towards the C terminal of human MCM6
Sequence RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPY LVVNPNYLLE
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Rabbit : 100%, Mouse : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against MCM6. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name MCM6
Background The protein encoded by the MCM6 gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.
Molecular Weight 90kDa
Gene ID 4175
NCBI Accession NP_005906, NM_005915
UniProt Q14566
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MCM6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Yabuta, Kajimura, Mayanagi et al.: "Mammalian Mcm2/4/6/7 complex forms a toroidal structure." in: Genes to cells : devoted to molecular & cellular mechanisms, Vol. 8, Issue 5, pp. 413-21, 2003 (PubMed).

Alternatives for antigen "Minichromosome Maintenance Complex Component 6 (MCM6)", type "Antibodies"
Hosts (28), (3), (2)
Reactivities (30), (11), (6), (1)
Applications (31), (14), (11), (4), (2), (2), (2), (1), (1), (1)
Epitopes (5), (4), (2), (2), (2), (1)
Beacon