Minichromosome Maintenance Complex Component 6 (MCM6) (C-Term) antibody

Details for Product No. ABIN183379
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms Mis5, P105MCM, MCG40308, Mcmd6, ASP-l1, D1Wsu22e, CG4039, DmMCM6, DmeMCM6, Dmel\\CG4039, MCM6, McM6, fs(1)K1214, mcm6
Epitope
C-Term
(5), (4), (2), (1), (1)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(27), (11), (7), (1)
Host
Rabbit
(24), (4), (2)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(29), (11), (10), (5), (3), (2), (1), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183379
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human MCM6
Sequence RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPY LVVNPNYLLE
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Rabbit : 100 %, Mouse : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against MCM6. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name MCM6
Background The protein encoded by the MCM6 gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.
Molecular Weight 90 kDa
Gene ID 4175
NCBI Accession NM_005915, NP_005906
UniProt Q14566
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 821 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Minichromosome Maintenance Complex Component 6 (MCM6) (C-Term) antibody anti-Minichromosome Maintenance Complex Component 6 (MCM6) (C-Term) antibody
anti-Minichromosome Maintenance Complex Component 6 (MCM6) (C-Term) antibody (2) anti-Minichromosome Maintenance Complex Component 6 (MCM6) (C-Term) antibody (Image 2)
Background publications Yabuta, Kajimura, Mayanagi et al.: "Mammalian Mcm2/4/6/7 complex forms a toroidal structure." in: Genes to cells : devoted to molecular & cellular mechanisms, Vol. 8, Issue 5, pp. 413-21, 2003 (PubMed).

Hosts (24), (4), (2)
Reactivities (27), (11), (7), (1)
Applications (29), (11), (10), (5), (3), (2), (1), (1), (1), (1)
Epitopes (5), (4), (2), (1), (1)
back to top