Did you know that you can buy products from over 140 different suppliers from us?

TRAF Family Member-Associated NFKB Activator (TANK) (C-Term) antibody

Details for Product No. ABIN183653
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms I-TRAF, ITRAF, TRAF2, C86182, E430026L09Rik
Epitope
C-Term
(16), (13), (7), (4), (3), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Human
(81), (35), (34), (1), (1), (1)
Host
Rabbit
(76), (3), (3), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(72), (33), (19), (18), (10), (9), (9), (7), (6), (3), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183653
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human TANK
Sequence KPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSR GDFLRHLNSH
Predicted Reactivity Human : 100 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against TANK. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TANK
Background The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor superfamily. TANK is found in the cytoplasm and can bind to TRAF1, TRAF2, or TRAF3, ther
Molecular Weight 48 kDa
Gene ID 10010
NCBI Accession NM_004180, NP_004171
UniProt Q92844
Research Area Immunology, Innate Immunity
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 425 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-TRAF Family Member-Associated NFKB Activator (TANK) (C-Term) antibody WB Suggested Anti-TANK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Bouwmeester, Bauch, Ruffner et al.: "A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway...." in: Nature cell biology, Vol. 6, Issue 2, pp. 97-105, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183653
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top