Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183653

TRAF Family Member-Associated NFKB Activator (TANK) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms I-TRAF, ITRAF, TRAF2, C86182, E430026L09Rik
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183653
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TANK antibody: synthetic peptide directed towards the C terminal of human TANK
Sequence KPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSR GDFLRHLNSH
Predicted Reactivity Human : 100%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against TANK. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TANK
Background The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor superfamily. TANK is found in the cytoplasm and can bind to TRAF1, TRAF2, or TRAF3, ther
Molecular Weight 48kDa
Gene ID 10010
NCBI Accession NP_004171, NM_004180
UniProt Q92844
Research Area Immunology, Innate Immunity
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TANK antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Bouwmeester, Bauch, Ruffner et al.: "A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway." in: Nature cell biology, Vol. 6, Issue 2, pp. 97-105, 2004 (PubMed).

Alternatives for antigen "TRAF Family Member-Associated NFKB Activator (TANK)", type "Antibodies"
Hosts (68), (4), (3), (1)
Reactivities (74), (37), (36), (3), (2), (1), (1), (1), (1), (1)
Applications (66), (24), (20), (13), (10), (9), (8), (6), (3), (3), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (15), (12), (5), (4), (2), (2), (1), (1), (1), (1)
Beacon