ERK1 antibody (AA 372-406)
-
- Target See all ERK1 (MAPK3) Antibodies
- ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
-
Binding Specificity
- AA 372-406
-
Reactivity
- Mouse, Rat, Rabbit, Hamster
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ERK1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunoprecipitation (IP), Functional Studies (Func)
- Specificity
- Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species cross-reactivity: Human, mouse, chicken and starfish. Species sequence Homology: Chinese hamster: 35/35, mouse: 34/35, human: 32/35.
- Predicted Reactivity
- Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%) Monkey, Bovine, Dog, Bat, Horse, Platypus (97%) Human, Gorilla, Gibbon, Elephant (94%) Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%) Xenopus (84%).
- Purification
- Immunoaffinity purified
- Immunogen
-
Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled). Percent identity by BLAST analysis: Marmoset, Mouse, Rat, Hamster, Panda, Rabbit, Opossum (100%), Monkey, Bovine, Dog, Bat, Horse, Platypus (97%), Human, Gorilla, Gibbon, Elephant (94%), Orangutan, Pig, Turkey, Chicken, Pufferfish, Zebrafish (87%), Xenopus (84%).
Type of Immunogen: Synthetic peptide - KLH conjugated - Isotype
- IgG
- Top Product
- Discover our top product MAPK3 Primary Antibody
-
-
- Application Notes
-
Approved: Func, IP, WB (0.1 - 2 μg/mL)
Usage: Suitable for use in Western Blot and Immunoprecipitation. Western Blot: 0.1-2 μg/mL detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells. 3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1 μg/mL). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunoprecipitation Kinase Assay: 4 μg immunoprecipitates active MAP kinases from a lysate of NGF-stimulated (50 ng/mL) PC-12 cells, as demonstrated using the MAPK Immunoprecipitation Kinase Cascade Kit. - Comment
-
Target Species of Antibody: Rat
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- 0.2 M Tris-glycine, pH 7.4, 0.15 M sodium chloride, 0.05 % sodium azide, 0.1 mM EDTA.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeat freeze-thaw cycles.
- Storage
- 4 °C,-20 °C
- Storage Comment
- Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
-
- Target
- ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))
- Alternative Name
- MAPK3 / ERK1 (MAPK3 Products)
- Synonyms
- ERK-1 antibody, ERK1 antibody, ERT2 antibody, HS44KDAP antibody, HUMKER1A antibody, P44ERK1 antibody, P44MAPK antibody, PRKM3 antibody, p44-ERK1 antibody, p44-MAPK antibody, Erk-1 antibody, Erk1 antibody, Ert2 antibody, Esrk1 antibody, Mnk1 antibody, Mtap2k antibody, Prkm3 antibody, p44 antibody, p44erk1 antibody, p44mapk antibody, ERK3 antibody, ERK6 antibody, P38GAMMA antibody, PRKM12 antibody, SAPK-3 antibody, SAPK3 antibody, fi06b09 antibody, wu:fi06b09 antibody, zERK1 antibody, Tb08.10J17.940 antibody, MAPK1 antibody, MNK1 antibody, AW123708 antibody, Erk6 antibody, P38gamma antibody, Prkm12 antibody, Sapk3 antibody, ATMAPK3 antibody, ATMPK3 antibody, T6D9.4 antibody, mitogen-activated protein kinase 3 antibody, mitogen-activated protein kinase 3 antibody, mitogen-activated protein kinase 12 antibody, mitogen activated protein kinase 3 antibody, mitogen-activated serine/threonine-protein kinase antibody, MAPK3 antibody, Mapk3 antibody, MAPK12 antibody, mapk3 antibody, Tc00.1047053509475.10 antibody, Tb927.8.3550 antibody, Mapk12 antibody, CEK1 antibody, MPK3 antibody
- Background
-
Name/Gene ID: MAPK3
Subfamily: MAPK
Family: Protein Kinase
Synonyms: MAPK3, ERK-1, ERT2, HUMKER1A, HS44KDAP, MAP kinase 1, MAP kinase isoform p44, MAPK 1, MAPK 3, p44, p44MAPK, p44-MAPK, p44ERK1, Insulin-stimulated MAP2 kinase, MAP kinase 3, p44-ERK1, ERK1, PRKM3 - Gene ID
- 5595
- UniProt
- P27361
- Pathways
- MAPK Signaling, RTK Signaling, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteins
-